You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
Synonyms
  • Phosphatidylglycerophosphate synthase
  • PGP synthase
Gene NamePGS1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, for other substituted phosphate groups
Specific FunctionEssential for the viability of mitochondrial petite mutant. Catalyzes the committed step to the synthesis of the acidic phospholipids
Cellular LocationMitochondrion
SMPDB Pathways
Cardiolipin BiosynthesisPW002431 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/28:0)PW003484 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/10:0/30:0)PW003501 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/26:0)PW003502 ThumbThumb?image type=greyscaleThumb?image type=simple
Cardiolipin Biosynthesis CL(10:0/10:0/12:0/28:0)PW003503 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
CDP-DG(16:0/16:0) + Glycerol 3-phosphatePGP(16:0/16:0) + hydron + Cytidine monophosphate
CDP-DG(16:0/16:0) + Glycerol 3-phosphate PGP(14:0/14:0) + hydron + Cytidine monophosphate
CDP-DG(16:0/16:0) + Glycerol 3-phosphatePGP(14:0/14:0) + hydron + Cytidine monophosphate
CDP-DG(14:0/14:0) + Glycerol 3-phosphatePGP(14:0/14:0) + hydron + Cytidine monophosphate
CDP-DG(10:0/10:0) + Glycerol 3-phosphatePGP(10:0/10:0) + hydron + Cytidine monophosphate
KEGG Reactions
3-(3-sn-phosphatidyl)-sn-glycerol 1-phosphate + Cytidine monophosphate ↔ CDP-diacylglycerol + Glycerol 3-phosphate
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00406Cytidine monophosphateShow
YMDB00862hydronShow
YMDB12067CDP-DG(10:0/10:0)Show
YMDB12068CDP-DG(10:0/12:0)Show
YMDB12069CDP-DG(10:0/14:0)Show
YMDB12070CDP-DG(10:0/14:1(11Z))Show
YMDB12071CDP-DG(10:0/14:1(9Z))Show
YMDB12072CDP-DG(10:0/15:0)Show
YMDB12073CDP-DG(10:0/15:1(11Z))Show
YMDB12074CDP-DG(10:0/15:1(9Z))Show
YMDB12075CDP-DG(10:0/16:0)Show
YMDB12076CDP-DG(10:0/16:1(11Z))Show
YMDB12077CDP-DG(10:0/16:1(9Z))Show
YMDB12078CDP-DG(10:0/18:0)Show
YMDB12079CDP-DG(10:0/18:1(11Z))Show
YMDB12080CDP-DG(10:0/18:1(9Z))Show
YMDB12081CDP-DG(10:0/20:0)Show
YMDB12082CDP-DG(10:0/20:1(11Z))Show
YMDB12083CDP-DG(10:0/20:1(13Z))Show
YMDB12084CDP-DG(10:0/22:0)Show
YMDB12086CDP-DG(10:0/22:1(9Z))Show
YMDB12087CDP-DG(10:0/23:1(11Z))Show
YMDB12088CDP-DG(10:0/23:1(9Z))Show
YMDB12089CDP-DG(10:0/24:0)Show
YMDB12090CDP-DG(10:0/24:1(11Z))Show
YMDB12091CDP-DG(10:0/24:1(9Z))Show
YMDB12092CDP-DG(10:0/25:0)Show
YMDB12093CDP-DG(10:0/25:1(11Z))Show
YMDB12094CDP-DG(10:0/25:1(9Z))Show
YMDB12095CDP-DG(10:0/26:0)Show
YMDB12096CDP-DG(10:0/26:1(11Z))Show
YMDB12097CDP-DG(10:0/26:1(9Z))Show
YMDB12100CDP-DG(12:0/12:0)Show
YMDB12101CDP-DG(12:0/14:0)Show
YMDB12102CDP-DG(12:0/14:1(11Z))Show
YMDB12103CDP-DG(12:0/14:1(9Z))Show
YMDB12104CDP-DG(12:0/15:0)Show
YMDB12105CDP-DG(12:0/15:1(11Z))Show
YMDB12106CDP-DG(12:0/15:1(9Z))Show
YMDB12107CDP-DG(12:0/16:0)Show
YMDB12108CDP-DG(12:0/16:1(11Z))Show
YMDB12109CDP-DG(12:0/16:1(9Z))Show
YMDB12110CDP-DG(12:0/18:0)Show
YMDB12111CDP-DG(12:0/18:1(11Z))Show
YMDB12112CDP-DG(12:0/18:1(9Z))Show
YMDB12113CDP-DG(12:0/20:0)Show
YMDB12114CDP-DG(12:0/20:1(11Z))Show
YMDB12115CDP-DG(12:0/20:1(13Z))Show
YMDB12116CDP-DG(12:0/22:0)Show
YMDB12118CDP-DG(12:0/22:1(9Z))Show
YMDB12119CDP-DG(12:0/23:1(11Z))Show
YMDB12120CDP-DG(12:0/23:1(9Z))Show
YMDB12121CDP-DG(12:0/24:0)Show
YMDB12122CDP-DG(12:0/24:1(11Z))Show
YMDB12123CDP-DG(12:0/24:1(9Z))Show
YMDB12131CDP-DG(14:0/14:0)Show
YMDB12132CDP-DG(14:0/14:1(11Z))Show
YMDB12133CDP-DG(14:0/14:1(9Z))Show
YMDB12134CDP-DG(14:0/15:0)Show
YMDB12135CDP-DG(14:0/15:1(11Z))Show
YMDB12136CDP-DG(14:0/15:1(9Z))Show
YMDB12137CDP-DG(14:0/16:0)Show
YMDB12138CDP-DG(14:0/16:1(11Z))Show
YMDB12139CDP-DG(14:0/16:1(9Z))Show
YMDB12140CDP-DG(14:0/18:0)Show
YMDB12141CDP-DG(14:0/18:1(11Z))Show
YMDB12142CDP-DG(14:0/18:1(9Z))Show
YMDB12143CDP-DG(14:0/20:0)Show
YMDB12144CDP-DG(14:0/20:1(11Z))Show
YMDB12145CDP-DG(14:0/20:1(13Z))Show
YMDB12146CDP-DG(14:0/22:0)Show
YMDB12148CDP-DG(14:0/22:1(9Z))Show
YMDB12159CDP-DG(14:1(11Z)/14:1(11Z))Show
YMDB12160CDP-DG(14:1(11Z)/14:1(9Z))Show
YMDB12161CDP-DG(14:1(11Z)/15:0)Show
YMDB12162CDP-DG(14:1(11Z)/15:1(11Z))Show
YMDB12163CDP-DG(14:1(11Z)/15:1(9Z))Show
YMDB12164CDP-DG(14:1(11Z)/16:0)Show
YMDB12165CDP-DG(14:1(11Z)/16:1(11Z))Show
YMDB12166CDP-DG(14:1(11Z)/16:1(9Z))Show
YMDB12167CDP-DG(14:1(11Z)/18:0)Show
YMDB12168CDP-DG(14:1(11Z)/18:1(11Z))Show
YMDB12169CDP-DG(14:1(11Z)/18:1(9Z))Show
YMDB12170CDP-DG(14:1(11Z)/20:0)Show
YMDB12171CDP-DG(14:1(11Z)/20:1(11Z))Show
YMDB12172CDP-DG(14:1(11Z)/20:1(13Z))Show
YMDB12173CDP-DG(14:1(11Z)/22:0)Show
YMDB12175CDP-DG(14:1(11Z)/22:1(9Z))Show
YMDB12186CDP-DG(14:1(9Z)/14:1(11Z))Show
YMDB12187CDP-DG(14:1(9Z)/14:1(9Z))Show
YMDB12188CDP-DG(14:1(9Z)/15:0)Show
YMDB12189CDP-DG(14:1(9Z)/15:1(11Z))Show
YMDB12190CDP-DG(14:1(9Z)/15:1(9Z))Show
YMDB12191CDP-DG(14:1(9Z)/16:0)Show
YMDB12192CDP-DG(14:1(9Z)/16:1(11Z))Show
YMDB12193CDP-DG(14:1(9Z)/16:1(9Z))Show
YMDB12194CDP-DG(14:1(9Z)/18:0)Show
YMDB12195CDP-DG(14:1(9Z)/18:1(11Z))Show
YMDB12196CDP-DG(14:1(9Z)/18:1(9Z))Show
YMDB12197CDP-DG(14:1(9Z)/20:0)Show
YMDB12198CDP-DG(14:1(9Z)/20:1(11Z))Show
YMDB12199CDP-DG(14:1(9Z)/20:1(13Z))Show
YMDB12200CDP-DG(14:1(9Z)/22:0)Show
YMDB12202CDP-DG(14:1(9Z)/22:1(9Z))Show
YMDB12213CDP-DG(15:0/15:0)Show
YMDB12214CDP-DG(15:0/15:1(11Z))Show
YMDB12215CDP-DG(15:0/15:1(9Z))Show
YMDB12216CDP-DG(15:0/16:0)Show
YMDB12217CDP-DG(15:0/16:1(11Z))Show
YMDB12218CDP-DG(15:0/16:1(9Z))Show
YMDB12219CDP-DG(15:0/18:0)Show
YMDB12220CDP-DG(15:0/18:1(11Z))Show
YMDB12221CDP-DG(15:0/18:1(9Z))Show
YMDB12222CDP-DG(15:0/20:0)Show
YMDB12223CDP-DG(15:0/20:1(11Z))Show
YMDB12224CDP-DG(15:0/20:1(13Z))Show
YMDB12247CDP-DG(15:1(11Z)/15:1(11Z))Show
YMDB12248CDP-DG(15:1(11Z)/15:1(9Z))Show
YMDB12249CDP-DG(15:1(11Z)/16:0)Show
YMDB12250CDP-DG(15:1(11Z)/16:1(11Z))Show
YMDB12251CDP-DG(15:1(11Z)/16:1(9Z))Show
YMDB12252CDP-DG(15:1(11Z)/18:0)Show
YMDB12253CDP-DG(15:1(11Z)/18:1(11Z))Show
YMDB12254CDP-DG(15:1(11Z)/18:1(9Z))Show
YMDB12255CDP-DG(15:1(11Z)/20:0)Show
YMDB12256CDP-DG(15:1(11Z)/20:1(11Z))Show
YMDB12257CDP-DG(15:1(11Z)/20:1(13Z))Show
YMDB12280CDP-DG(15:1(9Z)/15:1(11Z))Show
YMDB12281CDP-DG(15:1(9Z)/15:1(9Z))Show
YMDB12282CDP-DG(15:1(9Z)/16:0)Show
YMDB12283CDP-DG(15:1(9Z)/16:1(11Z))Show
YMDB12284CDP-DG(15:1(9Z)/16:1(9Z))Show
YMDB12285CDP-DG(15:1(9Z)/18:0)Show
YMDB12286CDP-DG(15:1(9Z)/18:1(11Z))Show
YMDB12287CDP-DG(15:1(9Z)/18:1(9Z))Show
YMDB12288CDP-DG(15:1(9Z)/20:0)Show
YMDB12289CDP-DG(15:1(9Z)/20:1(11Z))Show
YMDB12290CDP-DG(15:1(9Z)/20:1(13Z))Show
YMDB12313CDP-DG(16:0/16:0)Show
YMDB12314CDP-DG(16:0/16:1(11Z))Show
YMDB12315CDP-DG(16:0/16:1(9Z))Show
YMDB12316CDP-DG(16:0/18:0)Show
YMDB12317CDP-DG(16:0/18:1(11Z))Show
YMDB12318CDP-DG(16:0/18:1(9Z))Show
YMDB12319CDP-DG(16:0/20:0)Show
YMDB12320CDP-DG(16:0/20:1(11Z))Show
YMDB12321CDP-DG(16:0/20:1(13Z))Show
YMDB12344CDP-DG(16:1(11Z)/16:1(11Z))Show
YMDB12345CDP-DG(16:1(11Z)/16:1(9Z))Show
YMDB12346CDP-DG(16:1(11Z)/18:0)Show
YMDB12347CDP-DG(16:1(11Z)/18:1(11Z))Show
YMDB12348CDP-DG(16:1(11Z)/18:1(9Z))Show
YMDB12349CDP-DG(16:1(11Z)/20:0)Show
YMDB12350CDP-DG(16:1(11Z)/20:1(11Z))Show
YMDB12351CDP-DG(16:1(11Z)/20:1(13Z))Show
YMDB12374CDP-DG(16:1(9Z)/16:1(11Z))Show
YMDB12375CDP-DG(16:1(9Z)/16:1(9Z))Show
YMDB12460CDP-DG(18:1(9Z)/18:1(9Z))Show
YMDB14166PGP(10:0/20:0)Show
YMDB14167PGP(10:0/20:1(11Z))Show
YMDB14168PGP(10:0/20:1(13Z))Show
YMDB14169PGP(10:0/22:0)Show
YMDB14170PGP(10:0/22:1(11Z))Show
YMDB14171PGP(10:0/22:1(9Z))Show
YMDB14172PGP(10:0/23:1(11Z))Show
YMDB14173PGP(10:0/23:1(9Z))Show
YMDB14174PGP(10:0/24:0)Show
YMDB14175PGP(10:0/24:1(11Z))Show
YMDB14176PGP(10:0/24:1(9Z))Show
YMDB14177PGP(10:0/25:0)Show
YMDB14178PGP(10:0/25:1(11Z))Show
YMDB14179PGP(10:0/25:1(9Z))Show
YMDB14180PGP(10:0/26:0)Show
YMDB14181PGP(10:0/26:1(11Z))Show
YMDB14182PGP(10:0/26:1(9Z))Show
YMDB14184PGP(12:0/18:0)Show
YMDB14185PGP(12:0/18:1(11Z))Show
YMDB14186PGP(12:0/18:1(9Z))Show
YMDB14187PGP(12:0/20:0)Show
YMDB14188PGP(12:0/20:1(11Z))Show
YMDB14189PGP(12:0/20:1(13Z))Show
YMDB14190PGP(12:0/22:0)Show
YMDB14191PGP(12:0/22:1(11Z))Show
YMDB14192PGP(12:0/22:1(9Z))Show
YMDB14193PGP(12:0/23:1(11Z))Show
YMDB14194PGP(12:0/23:1(9Z))Show
YMDB14195PGP(12:0/24:0)Show
YMDB14196PGP(12:0/24:1(11Z))Show
YMDB14197PGP(12:0/24:1(9Z))Show
YMDB14205PGP(14:0/15:0)Show
YMDB14206PGP(14:0/16:0)Show
YMDB14207PGP(14:0/16:1(11Z))Show
YMDB14208PGP(14:0/16:1(9Z))Show
YMDB14209PGP(14:0/18:0)Show
YMDB14210PGP(14:0/18:1(11Z))Show
YMDB14211PGP(14:0/18:1(9Z))Show
YMDB14212PGP(14:0/20:0)Show
YMDB14213PGP(14:0/20:1(11Z))Show
YMDB14214PGP(14:0/20:1(13Z))Show
YMDB14215PGP(14:0/22:0)Show
YMDB14216PGP(14:0/22:1(11Z))Show
YMDB14217PGP(14:0/22:1(9Z))Show
YMDB14228PGP(14:1(11Z)/16:0)Show
YMDB14229PGP(14:1(11Z)/16:1(11Z))Show
YMDB14230PGP(14:1(11Z)/16:1(9Z))Show
YMDB14231PGP(14:1(11Z)/18:0)Show
YMDB14232PGP(14:1(11Z)/18:1(11Z))Show
YMDB14233PGP(14:1(11Z)/18:1(9Z))Show
YMDB14234PGP(14:1(11Z)/20:0)Show
YMDB14235PGP(14:1(11Z)/20:1(11Z))Show
YMDB14236PGP(14:1(11Z)/20:1(13Z))Show
YMDB14237PGP(14:1(11Z)/22:0)Show
YMDB14238PGP(14:1(11Z)/22:1(11Z))Show
YMDB14239PGP(14:1(11Z)/22:1(9Z))Show
YMDB14250PGP(14:1(9Z)/16:0)Show
YMDB14251PGP(14:1(9Z)/16:1(11Z))Show
YMDB14252PGP(14:1(9Z)/16:1(9Z))Show
YMDB14253PGP(14:1(9Z)/18:0)Show
YMDB14254PGP(14:1(9Z)/18:1(11Z))Show
YMDB14255PGP(14:1(9Z)/18:1(9Z))Show
YMDB14256PGP(14:1(9Z)/20:0)Show
YMDB14257PGP(14:1(9Z)/20:1(11Z))Show
YMDB14258PGP(14:1(9Z)/20:1(13Z))Show
YMDB14259PGP(14:1(9Z)/22:0)Show
YMDB14260PGP(14:1(9Z)/22:1(11Z))Show
YMDB14261PGP(14:1(9Z)/22:1(9Z))Show
YMDB14272PGP(15:0/15:0)Show
YMDB14273PGP(15:0/15:1(11Z))Show
YMDB14274PGP(15:0/15:1(9Z))Show
YMDB14275PGP(15:0/16:0)Show
YMDB14276PGP(15:0/16:1(11Z))Show
YMDB14277PGP(15:0/16:1(9Z))Show
YMDB14278PGP(15:0/18:0)Show
YMDB14279PGP(15:0/18:1(11Z))Show
YMDB14280PGP(15:0/18:1(9Z))Show
YMDB14281PGP(15:0/20:0)Show
YMDB14282PGP(15:0/20:1(11Z))Show
YMDB14283PGP(15:0/20:1(13Z))Show
YMDB14306PGP(15:1(11Z)/15:1(11Z))Show
YMDB14307PGP(15:1(11Z)/15:1(9Z))Show
YMDB14308PGP(15:1(11Z)/16:0)Show
YMDB14309PGP(15:1(11Z)/16:1(11Z))Show
YMDB14310PGP(15:1(11Z)/16:1(9Z))Show
YMDB14311PGP(15:1(11Z)/18:0)Show
YMDB14312PGP(15:1(11Z)/18:1(11Z))Show
YMDB14313PGP(15:1(11Z)/18:1(9Z))Show
YMDB14314PGP(15:1(11Z)/20:0)Show
YMDB14315PGP(15:1(11Z)/20:1(11Z))Show
YMDB14316PGP(15:1(11Z)/20:1(13Z))Show
YMDB14339PGP(15:1(9Z)/15:1(11Z))Show
YMDB14340PGP(15:1(9Z)/15:1(9Z))Show
YMDB14341PGP(15:1(9Z)/16:0)Show
YMDB14342PGP(15:1(9Z)/16:1(11Z))Show
YMDB14343PGP(15:1(9Z)/16:1(9Z))Show
YMDB14344PGP(15:1(9Z)/18:0)Show
YMDB14345PGP(15:1(9Z)/18:1(11Z))Show
YMDB14346PGP(15:1(9Z)/18:1(9Z))Show
YMDB14347PGP(15:1(9Z)/20:0)Show
YMDB14348PGP(15:1(9Z)/20:1(11Z))Show
YMDB14349PGP(15:1(9Z)/20:1(13Z))Show
YMDB14372PGP(16:0/16:0)Show
YMDB14373PGP(16:0/16:1(11Z))Show
YMDB14374PGP(16:0/16:1(9Z))Show
YMDB14375PGP(16:0/18:0)Show
YMDB14376PGP(16:0/18:1(11Z))Show
YMDB14377PGP(16:0/18:1(9Z))Show
YMDB14378PGP(16:0/20:0)Show
YMDB14379PGP(16:0/20:1(11Z))Show
YMDB14380PGP(16:0/20:1(13Z))Show
YMDB14403PGP(16:1(11Z)/16:1(11Z))Show
YMDB14404PGP(16:1(11Z)/16:1(9Z))Show
YMDB14405PGP(16:1(11Z)/18:0)Show
YMDB14406PGP(16:1(11Z)/18:1(11Z))Show
YMDB14407PGP(16:1(11Z)/18:1(9Z))Show
YMDB14408PGP(16:1(11Z)/20:0)Show
YMDB14409PGP(16:1(11Z)/20:1(11Z))Show
YMDB14410PGP(16:1(11Z)/20:1(13Z))Show
YMDB14433PGP(16:1(9Z)/16:1(11Z))Show
YMDB14434PGP(16:1(9Z)/16:1(9Z))Show
YMDB14519PGP(18:1(9Z)/18:1(9Z))Show
YMDB16287PGP(12:0/12:0)Show
YMDB16288PGP(14:0/14:0)Show
YMDB16290PGP(10:0/10:0)Show
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
Process
phospholipid biosynthetic process
metabolic process
organophosphate metabolic process
phospholipid metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCL004W
Gene Sequence>1566 bp ATGACGACTCGTTTGCTCCAACTCACTCGTCCTCATTACAGATTATTATCCCTACCTCTC CAGAAACCCTTCAATATAAAAAGGCAGATGTCCGCTGCGAACCCTTCTCCATTTGGCAAT TATTTGAACACGATCACTAAGTCCCTACAACAGAATTTACAAACATGCTTTCATTTCCAA GCAAAAGAAATCGATATAATCGAATCTCCATCTCAGTTTTACGATCTCTTGAAGACAAAA ATACTTAATTCACAAAATAGAATATTCATTGCGTCTCTGTATTTAGGCAAAAGCGAGACT GAGTTGGTGGACTGCATATCCCAGGCATTGACCAAGAACCCCAAGTTGAAAGTTTCTTTT CTACTTGATGGCCTTCGAGGAACAAGAGAATTGCCTTCCGCCTGTTCCGCCACTTTATTA TCGTCTTTAGTAGCCAAATATGGGTCAGAGAGAGTGGATTGCCGATTGTACAAGACGCCT GCTTATCATGGTTGGAAAAAAGTCTTGGTTCCCAAGAGATTTAATGAAGGTTTAGGCTTA CAACATATGAAAATATATGGGTTTGATAACGAGGTCATTCTTTCGGGAGCCAACCTTTCG AACGACTATTTCACCAACAGACAAGATAGATACTATCTCTTTAAATCTCGAAACTTCTCC AACTATTATTTTAAATTACATCAACTCATAAGTTCCTTCAGTTATCAGATTATAAAGCCA ATGGTGGATGGTAGCATCAACATCATTTGGCCAGATTCGAATCCTACTGTTGAACCGACG AAAAATAAAAGGCTGTTTTTAAGGGAAGCATCTCAATTACTAGATGGCTTTTTAAAGAGT TCTAAACAAAGCCTCCCGATTACTGCCGTGGGTCAATTCTCCACATTAGTTTACCCAATT TCTCAATTCACTCCACTTTTTCCCAAATATAATGACAAATCGACCGAAAAAAGAACAATA TTGTCATTGCTTTCCACTATAACAAGCAATGCCATTTCTTGGACGTTCACTGCAGGATAC TTCAATATTTTGCCAGACATCAAAGCAAAACTGCTGGCAACGCCGGTTGCTGAGGCAAAT GTAATAACAGCTTCCCCCTTTGCAAACGGCTTTTACCAATCAAAGGGCGTCTCATCAAAT TTACCTGGTGCTTACTTGTACCTGTCAAAAAAATTTCTACAAGATGTATGTAGGTACAGA CAAGATCATGCTATTACATTAAGAGAATGGCAAAGAGGCGTAGTAAATAAGCCGAATGGT TGGTCATATCACGCAAAAGGTATTTGGCTTTCCGCTCGTGATAAAAATGATGCTAACAAT TGGAAACCCTTTATCACGGTTATAGGATCTTCAAACTATACGAGAAGGGCGTATTCATTA GATTTGGAATCGAATGCTCTCATTATTACAAGAGATGAAGAGCTAAGAAAAAAAATGAAA GCAGAGTTAGATAATTTATTACAATATACAAAACCTGTAACTCTAGAAGACTTTCAATCA GACCCAGAAAGACATGTTGGCACTGGTGTAAAGATAGCTACCTCCATTTTGGGTAAAAAA CTTTAG
Protein Properties
Pfam Domain Function
Protein Residues521
Protein Molecular Weight59369.69922
Protein Theoretical pI10.15
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase MTTRLLQLTRPHYRLLSLPLQKPFNIKRQMSAANPSPFGNYLNTITKSLQQNLQTCFHFQ AKEIDIIESPSQFYDLLKTKILNSQNRIFIASLYLGKSETELVDCISQALTKNPKLKVSF LLDGLRGTRELPSACSATLLSSLVAKYGSERVDCRLYKTPAYHGWKKVLVPKRFNEGLGL QHMKIYGFDNEVILSGANLSNDYFTNRQDRYYLFKSRNFSNYYFKLHQLISSFSYQIIKP MVDGSINIIWPDSNPTVEPTKNKRLFLREASQLLDGFLKSSKQSLPITAVGQFSTLVYPI SQFTPLFPKYNDKSTEKRTILSLLSTITSNAISWTFTAGYFNILPDIKAKLLATPVAEAN VITASPFANGFYQSKGVSSNLPGAYLYLSKKFLQDVCRYRQDHAITLREWQRGVVNKPNG WSYHAKGIWLSARDKNDANNWKPFITVIGSSNYTRRAYSLDLESNALIITRDEELRKKMK AELDNLLQYTKPVTLEDFQSDPERHVGTGVKIATSILGKKL
References
External Links
ResourceLink
Saccharomyces Genome Database PGS1
Uniprot IDP25578
Uniprot NamePGPS1_YEAST
GenBank Gene IDAJ012047
Genebank Protein ID3808176
General Reference
  • Janitor, M., Jarosch, E., Schweyen, R. J., Subik, J. (1995). "Molecular characterization of the PEL1 gene encoding a putative phosphatidylserine synthase." Yeast 11:1223-1231.8553693
  • Chang, S. C., Heacock, P. N., Clancey, C. J., Dowhan, W. (1998). "The PEL1 gene (renamed PGS1) encodes the phosphatidylglycero-phosphate synthase of Saccharomyces cerevisiae." J Biol Chem 273:9829-9836.9545322
  • Janitor, M., Subik, J. (1993). "Molecular cloning of the PEL1 gene of Saccharomyces cerevisiae that is essential for the viability of petite mutants." Curr Genet 24:307-312.8252640
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Dzugasova, V., Obernauerova, M., Horvathova, K., Vachova, M., Zakova, M., Subik, J. (1998). "Phosphatidylglycerolphosphate synthase encoded by the PEL1/PGS1 gene in Saccharomyces cerevisiae is localized in mitochondria and its expression is regulated by phospholipid precursors." Curr Genet 34:297-302.9799363
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956