You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADP-dependent alcohol dehydrogenase 7
Synonyms
  • NADP-dependent alcohol dehydrogenase VII
  • ADHVII
Gene NameADH7
Enzyme Class
Biological Properties
General FunctionInvolved in zinc ion binding
Specific FunctionNADP-dependent alcohol dehydrogenase with a broad substrate specificity
Cellular LocationNot Available
SMPDB Pathways
Ethanol fermentationPW002448 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerol metabolismPW002407 ThumbThumb?image type=greyscaleThumb?image type=simple
Isoleucine degradationPW002491 ThumbThumb?image type=greyscaleThumb?image type=simple
Leucine DegradationPW002490 ThumbThumb?image type=greyscaleThumb?image type=simple
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerolipid metabolismec00561 Map00561
Glycolysis / Gluconeogenesisec00010 Map00010
Phenylalanine metabolismec00360 Map00360
Pyruvate metabolismec00620 Map00620
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
Glycerol + NADPGlyceraldehyde + NADPH + hydron
Phenylacetaldehyde + hydron + NADH2-phenylethanol + NAD
4-Hydroxyphenylacetaldehyde + NADH + hydronNAD + Tyrosol
Indoleacetaldehyde + NADH + hydronNAD + tryptophol
Acetaldehyde + hydron + NADHEthanol + NAD
KEGG Reactions
2-Methylbutanal + NADPH + hydronNADP + 2-methylbutan-1-ol
Phenylacetaldehyde + NADPH + hydronNADP + 2-phenylethanol
3-methylbutanal + NADPH + hydronNADP + isoamylol
isobutyraldehyde + NADPH + hydronNADP + isobutanol
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB00110NADShow
YMDB00116PhenylacetaldehydeShow
YMDB00143NADHShow
YMDB00283GlycerolShow
YMDB00354IndoleacetaldehydeShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00482isobutyraldehydeShow
YMDB004852-MethylbutanalShow
YMDB004993-methylbutanalShow
YMDB005672-methylbutan-1-olShow
YMDB00570isoamylolShow
YMDB00573isobutanolShow
YMDB00577tryptopholShow
YMDB00862hydronShow
YMDB00883EthanolShow
YMDB010722-phenylethanolShow
YMDB01798TyrosolShow
YMDB16128GlyceraldehydeShow
YMDB161644-HydroxyphenylacetaldehydeShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
oxidoreductase activity
zinc ion binding
catalytic activity
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR105W
Gene Sequence>1086 bp ATGCTTTACCCAGAAAAATTTCAGGGCATCGGTATTTCCAACGCAAAGGATTGGAAGCAT CCTAAATTAGTGAGTTTTGACCCAAAACCCTTTGGCGATCATGACGTTGATGTTGAAATT GAAGCCTGTGGTATCTGCGGATCTGATTTTCATATAGCCGTTGGTAATTGGGGTCCAGTC CCAGAAAATCAAATCCTTGGACATGAAATAATTGGCCGCGTGGTGAAGGTTGGATCCAAG TGCCACACTGGGGTAAAAATCGGTGACCGTGTTGGTGTTGGTGCCCAAGCCTTGGCGTGT TTTGAGTGTGAACGTTGCAAAAGTGACAACGAGCAATACTGTACCAATGACCACGTTTTG ACTATGTGGACTCCTTACAAGGACGGCTACATTTCACAAGGAGGCTTTGCCTCCCACGTG AGGCTTCATGAACACTTTGCTATTCAAATACCAGAAAATATTCCAAGTCCGCTAGCCGCT CCATTATTGTGTGGTGGTATTACAGTTTTCTCTCCACTACTAAGAAATGGCTGTGGTCCA GGTAAGAGGGTAGGTATTGTTGGCATCGGTGGTATTGGGCATATGGGGATTCTGTTGGCT AAAGCTATGGGAGCCGAGGTTTATGCGTTTTCGCGAGGCCACTCCAAGCGGGAGGATTCT ATGAAACTCGGTGCTGATCACTATATTGCTATGTTGGAGGATAAAGGCTGGACAGAACAA TACTCTAACGCTTTGGACCTTCTTGTCGTTTGCTCATCATCTTTGTCGAAAGTTAATTTT GACAGTATCGTTAAGATTATGAAGATTGGAGGCTCCATCGTTTCAATTGCTGCTCCTGAA GTTAATGAAAAGCTTGTTTTAAAACCGTTGGGCCTAATGGGAGTATCAATCTCAAGCAGT GCTATCGGATCTAGGAAGGAAATCGAACAACTATTGAAATTAGTTTCCGAAAAGAATGTC AAAATATGGGTGGAAAAACTTCCGATCAGCGAAGAAGGCGTCAGCCATGCCTTTACAAGG ATGGAAAGCGGAGACGTCAAATACAGATTTACTTTGGTCGATTATGATAAGAAATTCCAT AAATAG
Protein Properties
Pfam Domain Function
Protein Residues361
Protein Molecular Weight39348.19922
Protein Theoretical pI7.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADP-dependent alcohol dehydrogenase 7 MLYPEKFQGIGISNAKDWKHPKLVSFDPKPFGDHDVDVEIEACGICGSDFHIAVGNWGPV PENQILGHEIIGRVVKVGSKCHTGVKIGDRVGVGAQALACFECERCKSDNEQYCTNDHVL TMWTPYKDGYISQGGFASHVRLHEHFAIQIPENIPSPLAAPLLCGGITVFSPLLRNGCGP GKRVGIVGIGGIGHMGILLAKAMGAEVYAFSRGHSKREDSMKLGADHYIAMLEDKGWTEQ YSNALDLLVVCSSSLSKVNFDSIVKIMKIGGSIVSIAAPEVNEKLVLKPLGLMGVSISSS AIGSRKEIEQLLKLVSEKNVKIWVEKLPISEEGVSHAFTRMESGDVKYRFTLVDYDKKFH K
References
External Links
ResourceLink
Saccharomyces Genome Database ADH7
Uniprot IDP25377
Uniprot NameADH7_YEAST
GenBank Gene IDX59720
Genebank Protein ID1907243
General Reference
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Larroy, C., Pares, X., Biosca, J. A. (2002). "Characterization of a Saccharomyces cerevisiae NADP(H)-dependent alcohol dehydrogenase (ADHVII), a member of the cinnamyl alcohol dehydrogenase family." Eur J Biochem 269:5738-5745.12423374
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358