Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEctonucleotide pyrophosphatase/phosphodiesterase 1
Synonyms
  • E-NPP 1
  • Alkaline phosphodiesterase 1
  • Nucleotide pyrophosphatase
  • NPPase
Gene NameNPP1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionMediates extracellular nucleotide derived phosphate hydrolysis along with NPP2 and PHO5
Cellular LocationMembrane; Single-pass type II membrane protein (Potential)
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
Pantothenate and CoA biosynthesisec00770 Map00770
Purine metabolismec00230 Map00230
Riboflavin metabolismec00740 Map00740
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00288Glucose 1-phosphateShow
YMDB00386D-Mannose 1-phosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR026C
Gene Sequence>2229 bp ATGGAACTTCAGAATGATTTAGAGTCGCTCGATAACGAGCTGAATGATTTTAGTGAAGAT CCATTTCGTGATGATTTCATAACGGATGAAGATGCTGTAAGATCGGGGTGGCGATCTGCG TGGACCAGGATGAAATATTGGTTTTATAAGAATAGACTGAAGTGGACAAACAATCCCATA GTGATTGGCGACGCGAAAGATAGTAGGGATGGTTCTAACTTTAGAAGGGGTATACCGCTA TATGAATTAGACGCGAATGGTCAACCCATTGATACTGAACTTGTTGATGAGAATGAACTT TCTTTTGGAACGGGATTTCATTCCAAAGTGCCTTTTAAAATAATATTTCGCACATTGTTT GGCTCGCTGGTGTTTGCCATTTTTTTAATTCTGATGATTAACATAGCAAAACCCCATCAC TCCACGAGAGTGCTATCGCACTTTGGCAGTCCTGAATTTGACCCTTACGTGAAGTATTTT AACGGTACGCATGAATTTTTCCCCTTAACGATAGTAATTTCACTAGACGGTTTCCATCCT TCACTCATATCTAAGAGGAACACACCGTTTTTACATGACTTATATGAATTGAAATATGAT GGAGGTATGAATATCACGTCCACACCTTTTATGGTACCCAGCTTCCCTACGGAGACCTTT CCCAACCATTGGACGTTGGTTACTGGACAATACCCAATACACCACGGTATAGTCTCTAAC GTATTTTGGGATCCTGATCTTAATGAGGAATTCCATCCAGGTGTATTGGACCCTCGAATA TGGAACAATAATGATACAGAACCAATATGGCAAACTGTTCAGTCTGCATTTGACGGTGAT ATACCATTCAAAGCTGCTACCCATATGTGGCCAGGTAGCGATGTGAATTATACCAAGTAT AATGAAGAGAAACTACAACCTGAACATAAAAATCCTATTGCTAGAGAGAGAACTCCATTT TACTTCGACGAATTCAATGCTAAAGAACCACTTTCGCAAAAATTATCCAAGATTATTGAA TATGTGGATATGAGTACACTGAACGAAAGACCACAGCTAATTCTCGGTTATGTACCGAAC GTAGATGCCTTTGGACATAAGCATGGATATCCGTCAGAGTCGGAATACTATTATGAAGAC TTCACTGAAACACTGGGGGAAGTAGATACATTTCTGAAGCAACTAGTGGAATCGCTGCAA GAAAGAAATTTAACCAGCTTTACTAATTTGGTCATTGTTAGCGATCATGGTATGAGCGAT ATCGTAGTTCCCTCAAATGTTATTATATGGGAAGACTTACTGGACGAAAAATTGAGGAAG GATTATGTATCGCACGCATATCTAGAGGGTCCGATGATGGCTATATCGTTGAAAGATTCC GGAAACATCAATGAGGTTTACCACAATTTAAAGACTTCTATAGATGAAGACAAGTATACG GTTTACGTTAATGGAAATTTCCCCAAAGAATGGAACTTTAATGATGGAAAAAATCATCAC ATGGCGTCAATCTGGATTGTGCCCGAGCCTGGGTATGCAGTGATGAAGAAAGAACAATTG AAGAAGGTGGCAAAAGGTGATCATAAGGACAAAAACGAAGACAATGTGTTCACGATTGGA TCACATGGATACGACAATAACGCGATCGATATGAGATCTGTATTTATTGGTATGGGGCCA TATTTTCCACAGGGATACATTGAGCCGTTCCAAAATACCGAAATTTACAACCTTTTGTGT GATATTTGCGGTGTGGCAGAAAAGGACAGAAATTCCAATGATGGGACTGGGATGCTTATG AACCAACTCCGCGAACCCCAGAGCAGCGAAGAAGTAGAGATTGAAGATGACTTTGATTAT TTGGTCAGTAAGTTTGGTGAATTCAGCACTTATAATATAATTTGGGGCGGGTACCCCGAA GAGACAGAACAAGACAATGTTGACAATGATAATGATGACAACGACGATGGAAACACTGAT GAAATAGCCGCTATGCCATCTTCGTCATTAACGATAAAACTAGAAATGACAACTTCAATA CCATCAGCAACTGAGACTCTACTGGGCGAAACATCACCATCATCAAGAAGCAGCAGCAGC AGCAGCATACAAGCTAGCGCTACTGCTAGCACAGTGGGGGATTGGCTTCAAGACATAATC AACGACGCAAAAGATCTCATTGACGACATAATTGACAGCATCGACGATTTAGTCGATTCT GATACCTAA
Protein Properties
Pfam Domain Function
Protein Residues742
Protein Molecular Weight84733.20313
Protein Theoretical pI4.24
Signalling Regions
  • None
Transmembrane Regions
  • 114-134
Protein Sequence>Ectonucleotide pyrophosphatase/phosphodiesterase 1 MELQNDLESLDNELNDFSEDPFRDDFITDEDAVRSGWRSAWTRMKYWFYKNRLKWTNNPI VIGDAKDSRDGSNFRRGIPLYELDANGQPIDTELVDENELSFGTGFHSKVPFKIIFRTLF GSLVFAIFLILMINIAKPHHSTRVLSHFGSPEFDPYVKYFNGTHEFFPLTIVISLDGFHP SLISKRNTPFLHDLYELKYDGGMNITSTPFMVPSFPTETFPNHWTLVTGQYPIHHGIVSN VFWDPDLNEEFHPGVLDPRIWNNNDTEPIWQTVQSAFDGDIPFKAATHMWPGSDVNYTKY NEEKLQPEHKNPIARERTPFYFDEFNAKEPLSQKLSKIIEYVDMSTLNERPQLILGYVPN VDAFGHKHGYPSESEYYYEDFTETLGEVDTFLKQLVESLQERNLTSFTNLVIVSDHGMSD IVVPSNVIIWEDLLDEKLRKDYVSHAYLEGPMMAISLKDSGNINEVYHNLKTSIDEDKYT VYVNGNFPKEWNFNDGKNHHMASIWIVPEPGYAVMKKEQLKKVAKGDHKDKNEDNVFTIG SHGYDNNAIDMRSVFIGMGPYFPQGYIEPFQNTEIYNLLCDICGVAEKDRNSNDGTGMLM NQLREPQSSEEVEIEDDFDYLVSKFGEFSTYNIIWGGYPEETEQDNVDNDNDDNDDGNTD EIAAMPSSSLTIKLEMTTSIPSATETLLGETSPSSRSSSSSSIQASATASTVGDWLQDII NDAKDLIDDIIDSIDDLVDSDT
References
External Links
ResourceLink
Saccharomyces Genome Database NPP1
Uniprot IDP25353
Uniprot NameNPP1_YEAST
GenBank Gene IDX59720
Genebank Protein ID14588938
General Reference
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Bolle, P. A., Gilliquet, V., Berben, G., Dumont, J., Hilger, F. (1992). "The complete sequence of K3B, a 7.9 kb fragment between PGK1 and CRY1 on chromosome III, reveals the presence of seven open reading frames." Yeast 8:205-213.1574926
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kennedy, E. J., Pillus, L., Ghosh, G. (2005). "Pho5p and newly identified nucleotide pyrophosphatases/ phosphodiesterases regulate extracellular nucleotide phosphate metabolism in Saccharomyces cerevisiae." Eukaryot Cell 4:1892-1901.16278456
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Kung, L. A., Tao, S. C., Qian, J., Smith, M. G., Snyder, M., Zhu, H. (2009). "Global analysis of the glycoproteome in Saccharomyces cerevisiae reveals new roles for protein glycosylation in eukaryotes." Mol Syst Biol 5:308.19756047