Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAllantoicase
Synonyms
  • Allantoate amidinohydrolase
Gene NameDAL2
Enzyme Class
Biological Properties
General FunctionInvolved in allantoicase activity
Specific FunctionUtilization of purines as secondary nitrogen sources, when primary sources are limiting
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Allantoic acid + waterUrea + Ureidoglycolic acid
Metabolites
YMDB IDNameView
YMDB00003UreaShow
YMDB00199Allantoic acidShow
YMDB00377(S)-Ureidoglycolic acidShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
allantoicase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 9
LocusYIR029W
Gene Sequence>1032 bp ATGAAGTTTTTTAGTTTGGCAGATGAGGCAGAATTTAAGTCAATAATCATTTCAAAAAAC AAAGCAGTAGATGTTATAGGATCTAAGTTAGGTGGTCAAGTGGTTTCTTTTTCAGATGAA TGGTTTGCTTCTGCTGAAAATTTAATTCAGCCAACTGCTCCTATAAGGGATCCTACCAGA TTTGTTCATTCAGGCGCATGGTACGACGGCTGGGAAACACGAAGACATAATGAGATGGAA TACGATTGGGTTATCATCAAGATGGGAGTCGCTGCTGCCCATATTATTGGTGGTGAAATT GACACTGCGTTTTTCAATGGTAATCATGCACCATTTGTATCAATAGAGGCGCTCTATGAC GAGGGCGAAGAAGGTAATATAGTGGAAGATGACTCGCGTTGGGTTGAGATTGTTGAGAAA TTTGAGTGTGGTCCTTCGCAAAGGCATCTTTTCGTTAGAGGCAACGGCCTTACTAAAGAA AGGTTTACTCACATCAAGCTGAAGATGTACCCCGATGGAGGAATCGCCAGATTTAGATTA TACGGAAGAGTTGTTCCTCCAGAACTCAAAACGAAGGATCATATAATTGACTTGGCTTAT GTTTGCAATGGTGCTGTCGCTTTAAAGTATTCTGACCAACACTTCGGTTCAGTTGATAAT TTGCTACTGCCAGGTCGAGGTCATGATATGTCGGACGGCTGGGAAACCAAAAGATCGAGA CAACCAGGTCATACTGATTGGGCGGTAATTCAACTGGGCAGGGAGTCTTCTTTCATTGAG AAGATTATTGTTGATACGGCACACTTCAGGGGGAACTTCCCTCAGTTCATTACCGTGGAA GGTTGCTTGAAGGAGTCAGAATCAAGTGAGAACACTGGTGAAGGAACATGGGTAGAGCTA GTTGGTAAGTCAAAGACGGGGCCTGACAAAGAACATGTGTATGAAATACGTAAGAGTATA AGAGTCTCCCATGTCAAATTAACGATTATTCCAGATGGAGGAGTGAAAAGAATAAGAGTT TGGGGGTACTGA
Protein Properties
Pfam Domain Function
Protein Residues343
Protein Molecular Weight38713.5
Protein Theoretical pI6.33
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Allantoicase MKFFSLADEAEFKSIIISKNKAVDVIGSKLGGQVVSFSDEWFASAENLIQPTAPIRDPTR FVHSGAWYDGWETRRHNEMEYDWVIIKMGVAAAHIIGGEIDTAFFNGNHAPFVSIEALYD EGEEGNIVEDDSRWVEIVEKFECGPSQRHLFVRGNGLTKERFTHIKLKMYPDGGIARFRL YGRVVPPELKTKDHIIDLAYVCNGAVALKYSDQHFGSVDNLLLPGRGHDMSDGWETKRSR QPGHTDWAVIQLGRESSFIEKIIVDTAHFRGNFPQFITVEGCLKESESSENTGEGTWVEL VGKSKTGPDKEHVYEIRKSIRVSHVKLTIIPDGGVKRIRVWGY
References
External Links
ResourceLink
Saccharomyces Genome Database DAL2
Uniprot IDP25335
Uniprot NameALLC_YEAST
GenBank Gene IDM64720
Genebank Protein ID171368
PDB ID
1SG3
General Reference
  • Yoo, H. S., Cooper, T. G. (1991). "Sequences of two adjacent genes, one (DAL2) encoding allantoicase and another (DCG1) sensitive to nitrogen-catabolite repression in Saccharomyces cerevisiae." Gene 104:55-62.1916277
  • Lee, F. J., Moss, J. (1991). "Cloning of a Saccharomyces cerevisiae gene encoding a protein homologous to allantoicase of Neurospora crassa." Yeast 7:993-995.1839481
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Leulliot, N., Quevillon-Cheruel, S., Sorel, I., Graille, M., Meyer, P., Liger, D., Blondeau, K., Janin, J., van Tilbeurgh, H. (2004). "Crystal structure of yeast allantoicase reveals a repeated jelly roll motif." J Biol Chem 279:23447-23452.15020593
  • Xu, Q., Schwarzenbacher, R., Page, R., Sims, E., Abdubek, P., Ambing, E., Biorac, T., Brinen, L. S., Cambell, J., Canaves, J. M., Chiu, H. J., Dai, X., Deacon, A. M., DiDonato, M., Elsliger, M. A., Floyd, R., Godzik, A., Grittini, C., Grzechnik, S. K., Hampton, E., Jaroszewski, L., Karlak, C., Klock, H. E., Koesema, E., Kovarik, J. S., Kreusch, A., Kuhn, P., Lesley, S. A., Levin, I., McMullan, D., McPhillips, T. M., Miller, M. D., Morse, A., Moy, K., Ouyang, J., Quijano, K., Reyes, R., Rezezadeh, F., Robb, A., Spraggon, G., Stevens, R. C., van den Bedem, H., Velasquez, J., Vincent, J., von Delft, F., Wang, X., West, B., Wolf, G., Hodgson, K. O., Wooley, J., Wilson, I. A. (2004). "Crystal structure of an allantoicase (YIR029W) from Saccharomyces cerevisiae at 2.4 A resolution." Proteins 56:619-624.15229895