Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphomevalonate kinase
SynonymsNot Available
Gene NameERG8
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionATP + (R)-5-phosphomevalonate = ADP + (R)-5- diphosphomevalonate
Cellular LocationCytoplasm
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
Terpenoid backbone biosynthesisPW002485 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Terpenoid backbone biosynthesisec00900 Map00900
SMPDB Reactions
Adenosine triphosphate + Mevalonic acid-5PADP + 5-Diphosphomevalonic acid
KEGG Reactions
Adenosine triphosphate + Mevalonic acid-5P5-Diphosphomevalonic acid + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00181Mevalonic acid-5PShow
YMDB004035-Diphosphomevalonic acidShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
cellular metabolic process
phosphorus metabolic process
phosphate metabolic process
phosphorylation
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR220W
Gene Sequence>1356 bp ATGTCAGAGTTGAGAGCCTTCAGTGCCCCAGGGAAAGCGTTACTAGCTGGTGGATATTTA GTTTTAGATACAAAATATGAAGCATTTGTAGTCGGATTATCGGCAAGAATGCATGCTGTA GCCCATCCTTACGGTTCATTGCAAGGGTCTGATAAGTTTGAAGTGCGTGTGAAAAGTAAA CAATTTAAAGATGGGGAGTGGCTGTACCATATAAGTCCTAAAAGTGGCTTCATTCCTGTT TCGATAGGCGGATCTAAGAACCCTTTCATTGAAAAAGTTATCGCTAACGTATTTAGCTAC TTTAAACCTAACATGGACGACTACTGCAATAGAAACTTGTTCGTTATTGATATTTTCTCT GATGATGCCTACCATTCTCAGGAGGATAGCGTTACCGAACATCGTGGCAACAGAAGATTG AGTTTTCATTCGCACAGAATTGAAGAAGTTCCCAAAACAGGGCTGGGCTCCTCGGCAGGT TTAGTCACAGTTTTAACTACAGCTTTGGCCTCCTTTTTTGTATCGGACCTGGAAAATAAT GTAGACAAATATAGAGAAGTTATTCATAATTTAGCACAAGTTGCTCATTGTCAAGCTCAG GGTAAAATTGGAAGCGGGTTTGATGTAGCGGCGGCAGCATATGGATCTATCAGATATAGA AGATTCCCACCCGCATTAATCTCTAATTTGCCAGATATTGGAAGTGCTACTTACGGCAGT AAACTGGCGCATTTGGTTGATGAAGAAGACTGGAATATTACGATTAAAAGTAACCATTTA CCTTCGGGATTAACTTTATGGATGGGCGATATTAAGAATGGTTCAGAAACAGTAAAACTG GTCCAGAAGGTAAAAAATTGGTATGATTCGCATATGCCAGAAAGCTTGAAAATATATACA GAACTCGATCATGCAAATTCTAGATTTATGGATGGACTATCTAAACTAGATCGCTTACAC GAGACTCATGACGATTACAGCGATCAGATATTTGAGTCTCTTGAGAGGAATGACTGTACC TGTCAAAAGTATCCTGAAATCACAGAAGTTAGAGATGCAGTTGCCACAATTAGACGTTCC TTTAGAAAAATAACTAAAGAATCTGGTGCCGATATCGAACCTCCCGTACAAACTAGCTTA TTGGATGATTGCCAGACCTTAAAAGGAGTTCTTACTTGCTTAATACCTGGTGCTGGTGGT TATGACGCCATTGCAGTGATTACTAAGCAAGATGTTGATCTTAGGGCTCAAACCGCTAAT GACAAAAGATTTTCTAAGGTTCAATGGCTGGATGTAACTCAGGCTGACTGGGGTGTTAGG AAAGAAAAAGATCCGGAAACTTATCTTGATAAATAA
Protein Properties
Pfam Domain Function
Protein Residues451
Protein Molecular Weight50454.39844
Protein Theoretical pI6.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphomevalonate kinase MSELRAFSAPGKALLAGGYLVLDTKYEAFVVGLSARMHAVAHPYGSLQGSDKFEVRVKSK QFKDGEWLYHISPKSGFIPVSIGGSKNPFIEKVIANVFSYFKPNMDDYCNRNLFVIDIFS DDAYHSQEDSVTEHRGNRRLSFHSHRIEEVPKTGLGSSAGLVTVLTTALASFFVSDLENN VDKYREVIHNLAQVAHCQAQGKIGSGFDVAAAAYGSIRYRRFPPALISNLPDIGSATYGS KLAHLVDEEDWNITIKSNHLPSGLTLWMGDIKNGSETVKLVQKVKNWYDSHMPESLKIYT ELDHANSRFMDGLSKLDRLHETHDDYSDQIFESLERNDCTCQKYPEITEVRDAVATIRRS FRKITKESGADIEPPVQTSLLDDCQTLKGVLTCLIPGAGGYDAIAVITKQDVDLRAQTAN DKRFSKVQWLDVTQADWGVRKEKDPETYLDK
References
External Links
ResourceLink
Saccharomyces Genome Database ERG8
Uniprot IDP24521
Uniprot NameERG8_YEAST
GenBank Gene IDZ49939
Genebank Protein ID887601
General Reference
  • Tsay, Y. H., Robinson, G. W. (1991). "Cloning and characterization of ERG8, an essential gene of Saccharomyces cerevisiae that encodes phosphomevalonate kinase." Mol Cell Biol 11:620-631.1846667
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106