You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameConstitutive acid phosphatase
SynonymsNot Available
Gene NamePHO3
Enzyme Class
Biological Properties
General FunctionInvolved in acid phosphatase activity
Specific FunctionA phosphate monoester + H(2)O = an alcohol + phosphate
Cellular LocationCytoplasmic
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
Vitamin B1/Thiamine metabolismPW002486 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
Thiamine monophosphate + waterThiamine + phosphate
KEGG Reactions
water + thiamine(1+) diphosphate(1-) Thiamine + phosphate + hydron
Thiamine monophosphate + water Thiamine + phosphate
Metabolites
YMDB IDNameView
YMDB00164Thiamine monophosphateShow
YMDB00220ThiamineShow
YMDB00381Thiamine pyrophosphateShow
YMDB00774Thiamine(1+) monophosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
phosphoric ester hydrolase activity
phosphatase activity
acid phosphatase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
Process
Not Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR092C
Gene Sequence>1404 bp ATGTTTAAATCTGTTGTTTATTCAATTTTAGCCGCTTCTTTGGCCAATGCAGGTACCATT CCCTTAGGCAAACTAGCCGATGTCGACAAGATTGGTACCCAAAAAGATATCTTCCCATTT TTGGGTGGTGCCGGACCATACTACTCTTTCCCTGGCGACTATGGTATTTCTCGTGATTTG CCTGAAGGTTGTGAAATGAAGCAACTGCAAATGGTTGGTAGACATGGTGAAAGATACCCT ACTGTCAGTCTGGCTAAGACTATCAAGAGTACATGGTATAAGTTGAGCAATTACACTCGT CAATTCAACGGCTCATTGTCATTCTTGAACGATGATTACGAGTTTTTCATCCGTGATGAC GATGATTTGGAAATGGAAACCACTTTTGCCAACTCGGACGATGTTTTGAACCCATACACT GGTGAAATGAACGCCAAGAGACATGCTCGTGACTTCTTGGCTCAATACGGTTACATGGTC GAAAACCAAACCAGTTTCGCCGTTTTTACCTCTAATTCTAAGAGATGTCATGACACTGCT CAATATTTCATTGATGGTTTAGGTGACCAATTCAACATCACCTTGCAGACTGTCAGTGAA GCTGAATCCGCTGGTGCCAACACTTTGAGTGCTTGTAACTCATGTCCTGCTTGGGACTAC GATGCCAATGATGACATTGTAAATGAATACGACACAACCTACTTGGATGACATTGCCAAG AGATTGAACAAGGAAAACAAGGGTTTGAACTTGACCTCAACTGACGCTAGTACTTTATTC TCGTGGTGTGCATTTGAAGTGAACGCTAAAGGTTACAGTGATGTCTGTGATATTTTCACC AAGGATGAATTAGTCCATTACTCCTACTACCAAGACTTGCACACTTATTACCATGAGGGT CCAGGTTACGACATTATCAAGTCTGTCGGTTCCAACTTGTTCAATGCCTCAGTCAAATTA TTAAAGCAAAGTGAGATTCAAGACCAAAAGGTTTGGTTGAGTTTTACCCACGATACCGAT ATCCTAAACTTTTTGACCACCGCTGGTATAATTGACGACAAAAACAACTTAACTGCCGAA TACGTTCCATTCATGGGCAACACTTTCCACAGATCCTGGTACGTTCCTCAAGGTGCTCGT GTCTACACCGAAAAATTCCAATGTTCTAACGACACCTACGTCAGATACGTCATTAACGAT GCTGTTGTTCCAATTGAAACCTGTTCCACTGGTCCAGGGTTCTCTTGTGAAATCAATGAC TTCTACGACTATGCTGAAAAGAGAGTAGCCGGTACTGACTTCCTAAAGGTCTGTAACGTC AGCAGCGTCAGTAACTCTACTGAATTGACCTTCTACTGGGACTGGAACACTACTCATTAC AACGCCAGTCTATTGAGACAATAG
Protein Properties
Pfam Domain Function
Protein Residues467
Protein Molecular Weight52776.10156
Protein Theoretical pI4.21
Signalling Regions
  • 1-17
Transmembrane Regions
  • None
Protein Sequence>Constitutive acid phosphatase MFKSVVYSVLAAALVNAGTIPLGELADVAKIGTQEDIFPFLGGAGPYFSFPGDYGISRDL PEGCEMKQLQMLARHGERYPTYSKGATIMKTWYKLSNYTRQFNGSLSFLNDDYEFFIRDD DDLEMETTFANSDNVLNPYTGEMDAKRHAREFLAQYGYMFENQTSFPIFAASSERVHDTA QYFIDGLGDQFNISLQTVSEAMSAGANTLSAGNACPGWDEDANDDILDKYDTTYLDDIAK RLNKENKGLNLTSKDANTLFAWCAYELNARGYSDVCDIFTEDELVRYSYGQDLVSFYQDG PGYDMIRSVGANLFNATLKLLKQSETQDLKVWLSFTHDTDILNYLTTAGIIDDKNNLTAE YVPFMGNTFHKSWYVPQGARVYTEKFQCSNDTYVRYVINDAVVPIETCSTGPGFSCEIND FYDYAEKRVAGTDFLKVCNVSSVSNVTELTFYWDWNTTHYNDTLLKQ
References
External Links
ResourceLink
Saccharomyces Genome Database PHO3
Uniprot IDP24031
Uniprot NamePPA3_YEAST
GenBank Gene IDX01080
Genebank Protein ID758280
General Reference
  • Bajwa, W., Meyhack, B., Rudolph, H., Schweingruber, A. M., Hinnen, A. (1984). "Structural analysis of the two tandemly repeated acid phosphatase genes in yeast." Nucleic Acids Res 12:7721-7739.6093051
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106