You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol uptake/efflux facilitator protein
SynonymsNot Available
Gene NameFPS1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transporter activity
Specific FunctionChannel protein for glycerol. Has a role in both glycerol influx and efflux. Plays a role in osmoregulation:under osmotic stress the channel is apparently closed to allow accumulation of glycerol in the cell under hyperosmotic conditions
Cellular LocationMembrane; Multi-pass membrane protein (Probable)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00283GlycerolShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLL043W
Gene Sequence>2010 bp ATGAGTAATCCTCAAAAAGCTCTAAACGACTTTCTGTCCAGTGAATCTGTTCATACACAT GATAGTTCTAGGAAACAATCTAATAAGCAGTCATCCGACGAAGGACGCTCTTCATCACAA CCTTCACATCATCACTCTGGTGGTACTAACAACAATAATAACAATAATAATAATAATAAT AACAGTAACAACAACAACAACGGCAACGATGGGGGAAATGATGACGACTATGATTATGAA ATGCAAGATTATAGACCTTCTCCGCAAAGTGCGCGGCCTACTCCCACGTATGTTCCACAA TATTCTGTAGAAAGTGGGACTGCTTTCCCGATTCAAGAGGTTATTCCTAGCGCATACATT AACACACAAGATATAAACCATAAAGATAACGGTCCGCCGAGTGCAAGCAGTAATAGAGCA TTCAGGCCTAGAGGGCAGACCACAGTGTCGGCCAACGTGCTTAACATTGAAGATTTTTAC AAAAATGCAGACGATGCGCATACCATCCCGGAGTCACATTTATCGAGAAGGAGAAGTAGG TCGAGGGCTACGAGTAATGCTGGGCACAGTGCCAATACAGGCGCCACGAATGGCAGGACT ACTGGTGCCCAAACTAATATGGAAAGCAATGAATCACCACGTAACGTCCCCATTATGGTG AAGCCAAAGACATTATACCAGAACCCTCAAACACCTACAGTCTTGCCCTCCACATACCAT CCAATTAATAAATGGTCTTCCGTCAAAAACACTTATTTGAAGGAATTTTTAGCCGAGTTT ATGGGAACAATGGTTATGATTATTTTCGGTAGTGCTGTTGTTTGTCAGGTCAATGTTGCT GGGAAAATACAGCAGGACAATTTCAACGTGGCTTTGGATAACCTTAACGTTACCGGGTCT TCTGCAGAAACGATAGACGCTATGAAGAGTTTAACATCCTTGGTTTCATCCGTTGCGGGC GGTACCTTTGATGATGTGGCATTGGGCTGGGCTGCTGCCGTGGTGATGGGCTATTTCTGC GCTGGTGGTAGTGCCATCTCAGGTGCTCATTTGAATCCGTCTATTACATTAGCCAATTTG GTGTATAGAGGTTTTCCCCTGAAGAAAGTTCCTTATTACTTTGCTGGACAATTGATCGGT GCCTTCACAGGCGCTTTGATCTTGTTTATTTGGTACAAAAGGGTGTTACAAGAGGCATAT AGCGATTGGTGGATGAATGAAAGTGTTGCGGGAATGTTTTGCGTTTTTCCAAAGCCTTAT CTAAGTTCAGGACGGCAATTTTTTTCCGAATTTTTATGTGGAGCTATGTTACAAGCAGGA ACATTTGCGCTGACCGATCCTTATACGTGTTTGTCCTCTGATGTTTTCCCATTGATGATG TTTATTTTGATTTTCATTATCAATGCTTCCATGGCTTATCAGACAGGTACAGCAATGAAT TTGGCTCGTGATCTGGGCCCACGTCTTGCACTATATGCAGTTGGATTTGATCATAAAATG CTTTGGGTGCATCATCATCATTTCTTTTGGGTTCCCATGGTAGGCCCATTTATTGGTGCG TTAATGGGGGGGTTGGTTTACGATGTCTGTATTTATCAGGGTCATGAATCTCCAGTCAAC TGGTCTTTACCAGTTTATAAGGAAATGATTATGAGAGCCTGGTTTAGAAGGCCTGGTTGG AAGAAGAGAAATAGAGCAAGAAGAACATCGGACCTGAGTGACTTCTCATACAATAACGAT GATGATGAGGAATTTGGAGAAAGAATGGCTCTTCAAAAGACAAAGACCAAGTCATCTATT TCAGACAACGAAAATGAAGCAGGAGAAAAGAAAGTGCAATTTAAATCTGTTCAGCGCGGC AAAAGAACGTTTGGTGGTATACCAACAATTCTTGAAGAAGAAGATTCCATTGAAACTCGT TCGCTAGGTGCGACGACGACTGATTCTATTGGGTTATCCGACACATCATCAGAAGATTCG CATTATGGTAATGCTAAGAAGGTAACATGA
Protein Properties
Pfam Domain Function
Protein Residues669
Protein Molecular Weight73876.89844
Protein Theoretical pI6.9
Signalling Regions
  • None
Transmembrane Regions
  • 255-275
  • 326-346
  • 370-390
  • 447-467
  • 507-527
Protein Sequence>Glycerol uptake/efflux facilitator protein MSNPQKALNDFLSSESVHTHDSSRKQSNKQSSDEGRSSSQPSHHHSGGTNNNNNNNNNNN NSNNNNNGNDGGNDDDYDYEMQDYRPSPQSARPTPTYVPQYSVESGTAFPIQEVIPSAYI NTQDINHKDNGPPSASSNRAFRPRGQTTVSANVLNIEDFYKNADDAHTIPESHLSRRRSR SRATSNAGHSANTGATNGRTTGAQTNMESNESPRNVPIMVKPKTLYQNPQTPTVLPSTYH PINKWSSVKNTYLKEFLAEFMGTMVMIIFGSAVVCQVNVAGKIQQDNFNVALDNLNVTGS SAETIDAMKSLTSLVSSVAGGTFDDVALGWAAAVVMGYFCAGGSAISGAHLNPSITLANL VYRGFPLKKVPYYFAGQLIGAFTGALILFIWYKRVLQEAYSDWWMNESVAGMFCVFPKPY LSSGRQFFSEFLCGAMLQAGTFALTDPYTCLSSDVFPLMMFILIFIINASMAYQTGTAMN LARDLGPRLALYAVGFDHKMLWVHHHHFFWVPMVGPFIGALMGGLVYDVCIYQGHESPVN WSLPVYKEMIMRAWFRRPGWKKRNRARRTSDLSDFSYNNDDDEEFGERMALQKTKTKSSI SDNENEAGEKKVQFKSVQRGKRTFGGIPTILEEEDSIETASLGATTTDSIGLSDTSSEDS HYGNAKKVT
References
External Links
ResourceLink
Saccharomyces Genome Database FPS1
Uniprot IDP23900
Uniprot NameFPS1_YEAST
GenBank Gene IDX54157
Genebank Protein ID3704
General Reference
  • Van Aelst, L., Hohmann, S., Zimmermann, F. K., Jans, A. W., Thevelein, J. M. (1991). "A yeast homologue of the bovine lens fibre MIP gene family complements the growth defect of a Saccharomyces cerevisiae mutant on fermentable sugars but not its defect in glucose-induced RAS-mediated cAMP signalling." EMBO J 10:2095-2104.1648479
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Luyten, K., Albertyn, J., Skibbe, W. F., Prior, B. A., Ramos, J., Thevelein, J. M., Hohmann, S. (1995). "Fps1, a yeast member of the MIP family of channel proteins, is a facilitator for glycerol uptake and efflux and is inactive under osmotic stress." EMBO J 14:1360-1371.7729414
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956