You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucan 1,3-beta-glucosidase I/II
Synonyms
  • Exo-1,3-beta-glucanase I/II
  • Soluble cell wall protein 6
Gene NameEXG1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionGlucanases possibly play a role in cell expansion during growth, in cell-cell fusion during mating, and in spore release during sporulation. This enzyme hydrolyzes both 1,3-beta- and 1,6- beta-linkages and even has beta-glucosidase activity. It could also function biosynthetically as a transglycosylase
Cellular LocationSecreted, cell wall. Secreted
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Alpha-D-Glucose + 1,3-beta-D-Glucan1,3-beta-D-Glucan + water
KEGG Reactions
water + (1->3)-beta-D-glucan D-Glucose
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
YMDB163141,3-beta-D-GlucanShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR300W
Gene Sequence>1347 bp ATGCTTTCGCTTAAAACGTTACTGTGTACGTTGTTGACTGTGTCATCAGTACTCGCTACC CCAGTCCCTGCAAGAGACCCTTCTTCCATTCAATTTGTTCATGAGGAGAACAAGAAAAGA TACTACGATTATGACCACGGTTCCCTCGGAGAACCAATCCGTGGTGTCAACATTGGTGGT TGGTTACTTCTTGAACCATACATTACTCCATCTTTGTTCGAGGCTTTCCGTACAAATGAT GACAACGACGAAGGAATTCCTGTCGACGAATATCACTTCTGTCAATATTTAGGTAAGGAT TTGGCTAAAAGCCGTTTACAGAGCCATTGGTCTACTTTCTACCAAGAACAAGATTTCGCT AATATTGCTTCCCAAGGTTTCAACCTTGTCAGAATTCCTATCGGTTACTGGGCTTTCCAA ACTTTGGACGATGATCCTTATGTTAGCGGCCTACAGGAATCTTACCTAGACCAAGCCATC GGTTGGGCTAGAAACAACAGCTTGAAAGTTTGGGTTGATTTGCATGGTGCCGCTGGTTCG CAGAACGGGTTTGATAACTCTGGTTTGAGAGATTCATACAAGTTTTTGGAAGACAGCAAT TTGGCCGTTACTACAAATGTCTTGAACTACATATTGAAAAAATACTCTGCGGAGGAATAC TTGGACACTGTTATTGGTATCGAATTGATTAATGAGCCATTGGGTCCTGTTCTAGACATG GATAAAATGAAGAATGACTACTTGGCACCTGCTTACGAATACTTGAGAAACAACATCAAG AGTGACCAAGTTATCATCATCCATGACGCTTTCCAACCATACAATTATTGGGATGACTTC ATGACTGAAAACGATGGCTACTGGGGTGTCACTATCGACCATCATCACTACCAAGTCTTT GCTTCTGATCAATTGGAAAGATCCATTGATGAACATATTAAAGTAGCTTGTGAATGGGGT ACCGGAGTTTTGAATGAATCCCACTGGACTGTTTGTGGTGAGTTTGCTGCCGCTTTGACT GATTGTACAAAATGGTTGAATAGTGTTGGCTTCGGCGCTAGATACGACGGTTCTTGGGTC AATGGTGACCAAACATCTTCTTACATTGGCTCTTGTGCTAACAACGATGATATAGCTTAC TGGTCTGACGAAAGAAAGGAAAACACAAGACGTTATGTGGAGGCACAACTAGATGCCTTT GAAATGAGAGGGGGTTGGATTATCTGGTGTTACAAGACAGAATCTAGTTTGGAATGGGAT GCTCAAAGATTGATGTTCAATGGTTTATTCCCTCAACCATTGACTGACAGAAAGTATCCA AACCAATGTGGCACAATTTCTAACTAA
Protein Properties
Pfam Domain Function
Protein Residues448
Protein Molecular Weight51310.5
Protein Theoretical pI4.34
PDB Fileshow
Signalling Regions
  • 1-19
Transmembrane Regions
  • None
Protein Sequence>Glucan 1,3-beta-glucosidase I/II MLSLKTLLCTLLTVSSVLATPVPARDPSSIQFVHEENKKRYYDYDHGSLGEPIRGVNIGG WLLLEPYITPSLFEAFRTNDDNDEGIPVDEYHFCQYLGKDLAKSRLQSHWSTFYQEQDFA NIASQGFNLVRIPIGYWAFQTLDDDPYVSGLQESYLDQAIGWARNNSLKVWVDLHGAAGS QNGFDNSGLRDSYKFLEDSNLAVTTNVLNYILKKYSAEEYLDTVIGIELINEPLGPVLDM DKMKNDYLAPAYEYLRNNIKSDQVIIIHDAFQPYNYWDDFMTENDGYWGVTIDHHHYQVF ASDQLERSIDEHIKVACEWGTGVLNESHWTVCGEFAAALTDCTKWLNSVGFGARYDGSWV NGDQTSSYIGSCANNDDIAYWSDERKENTRRYVEAQLDAFEMRGGWIIWCYKTESSLEWD AQRLMFNGLFPQPLTDRKYPNQCGTISN
References
External Links
ResourceLink
Saccharomyces Genome Database EXG1
Uniprot IDP23776
Uniprot NameEXG1_YEAST
GenBank Gene IDAY693069
Genebank Protein ID51013589
PDB ID
1H4P
General Reference
  • Vazquez de Aldana, C. R., Correa, J., San Segundo, P., Bueno, A., Nebreda, A. R., Mendez, E., del Rey, F. (1991). "Nucleotide sequence of the exo-1,3-beta-glucanase-encoding gene, EXG1, of the yeast Saccharomyces cerevisiae." Gene 97:173-182.1900250
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ramirez, M., Munoz, M. D., Basco, R. D., Gimenez-Gallego, G., Hernandez, L. M., Larriba, G. (1990). "Two glycosylation patterns for a single protein (exoglucanase) in Saccharomyces cerevisiae." FEMS Microbiol Lett 59:43-48.2125957
  • Basco, R. D., Munoz, M. D., Hernandez, L. M., Vazquez de Aldana, C., Larriba, G. (1993). "Reduced efficiency in the glycosylation of the first sequon of Saccharomyces cerevisiae exoglucanase leads to the synthesis and secretion of a new glycoform of the molecule." Yeast 9:221-234.8488724
  • Cappellaro, C., Mrsa, V., Tanner, W. (1998). "New potential cell wall glucanases of Saccharomyces cerevisiae and their involvement in mating." J Bacteriol 180:5030-5037.9748433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Taylor, S. C., Ferguson, A. D., Bergeron, J. J., Thomas, D. Y. (2004). "The ER protein folding sensor UDP-glucose glycoprotein-glucosyltransferase modifies substrates distant to local changes in glycoprotein conformation." Nat Struct Mol Biol 11:128-134.14730348