You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHigh-affinity glucose transporter HXT2
SynonymsNot Available
Gene NameHXT2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionHigh-affinity glucose transporter. Is only indispensable for growth on low glucose-containing media, because S.cerevisiae possesses other sugar transporters
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
substrate-specific transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 13
LocusYMR011W
Gene Sequence>1626 bp ATGTCTGAATTCGCTACTAGCCGCGTTGAAAGTGGCTCTCAACAAACTTCTATCCACTCT ACTCCGATAGTGCAGAAATTAGAGACGGATGAATCTCCTATTCAAACCAAATCTGAATAC ACTAACGCTGAACTCCCAGCAAAGCCAATCGCCGCATATTGGACTGTTATCTGTTTATGT CTAATGATTGCATTTGGTGGGTTTGTCTTTGGTTGGGATACTGGTACCATCTCTGGTTTT GTTAATCAAACCGATTTCAAAAGAAGATTTGGTCAAATGAAATCTGATGGTACCTATTAT CTTTCGGACGTCCGGACTGGTTTGATCGTTGGTATCTTCAATATTGGTTGTGCCTTTGGT GGGTTAACCTTAGGACGTCTGGGTGATATGTATGGACGTAGAATTGGTTTGATGTGCGTC GTTCTGGTATACATCGTTGGTATTGTGATTCAAATTGCTTCTAGTGACAAATGGTACCAA TATTTCATTGGTAGAATTATCTCTGGTATGGGTGTCGGTGGTATTGCTGTCCTATCTCCA ACTTTGATTTCCGAAACAGCACCAAAACACATTAGAGGTACCTGTGTTTCTTTCTATCAG TTAATGATCACTCTAGGTATTTTCTTAGGTTACTGTACCAACTATGGTACTAAAGACTAC TCCAATTCAGTTCAATGGAGAGTGCCTTTGGGTTTGAACTTTGCCTTCGCTATTTTCATG ATCGCTGGTATGCTAATGGTTCCAGAATCTCCAAGATTCTTAGTCGAAAAAGGCAGATAC GAAGACGCTAAACGTTCTTTGGCAAAATCTAACAAAGTCACCATTGAAGATCCAAGTATT GTTGCTGAAATGGATACAATTATGGCCAACGTTGAAACTGAAAGATTAGCCGGTAACGCT TCTTGGGGTGAGTTATTCTCCAACAAAGGTGCTATTTTACCTCGTGTGATTATGGGTATT ATGATTCAATCCTTACAACAATTAACTGGTAACAATTACTTCTTCTATTATGGTACTACT ATTTTCAACGCCGTCGGTATGAAAGATTCTTTCCAAACTTCCATCGTTTTAGGTATAGTC AACTTCGCATCCACTTTCGTGGCCTTATACACTGTTGATAAATTTGGTCGTCGTAAGTGT CTATTGGGTGGTTCTGCTTCCATGGCCATTTGTTTTGTTATCTTCTCTACTGTCGGTGTC ACAAGCTTATATCCAAATGGTAAAGATCAACCATCTTCCAAGGCTGCCGGTAACGTCATG ATTGTCTTTACCTGTTTATTCATTTTCTTCTTCGCTATTAGTTGGGCCCCAATTGCCTAC GTTATTGTTGCCGAATCCTATCCTTTGCGTGTCAAAAATCGTGCTATGGCTATTGCTGTT GGTGCCAACTGGATTTGGGGTTTCTTGATTGGTTTCTTCACTCCCTTCATTACAAGTGCA ATTGGATTTTCATACGGGTATGTCTTCATGGGCTGTTTGGTATTTTCATTCTTCTACGTG TTTTTCTTTGTCTGTGAAACCAAGGGCTTAACATTAGAGGAAGTTAATGAAATGTATGTT GAAGGTGTCAAACCATGGAAATCTGGTAGCTGGATCTCAAAAGAAAAAAGAGTTTCCGAG GAATAA
Protein Properties
Pfam Domain Function
Protein Residues541
Protein Molecular Weight59840.19922
Protein Theoretical pI8.42
Signalling Regions
  • None
Transmembrane Regions
  • 50-70
  • 108-128
  • 135-155
  • 163-183
  • 193-213
  • 228-248
  • 328-347
  • 351-371
  • 380-400
  • 419-439
  • 457-477
  • 485-505
Protein Sequence>High-affinity glucose transporter HXT2 MSEFATSRVESGSQQTSIHSTPIVQKLETDESPIQTKSEYTNAELPAKPIAAYWTVICLC LMIAFGGFVFGWDTGTISGFVNQTDFKRRFGQMKSDGTYYLSDVRTGLIVGIFNIGCAFG GLTLGRLGDMYGRRIGLMCVVLVYIVGIVIQIASSDKWYQYFIGRIISGMGVGGIAVLSP TLISETAPKHIRGTCVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGLNFAFAIFM IAGMLMVPESPRFLVEKGRYEDAKRSLAKSNKVTIEDPSIVAEMDTIMANVETERLAGNA SWGELFSNKGAILPRVIMGIMIQSLQQLTGNNYFFYYGTTIFNAVGMKDSFQTSIVLGIV NFASTFVALYTVDKFGRRKCLLGGSASMAICFVIFSTVGVTSLYPNGKDQPSSKAAGNVM IVFTCLFIFFFAISWAPIAYVIVAESYPLRVKNRAMAIAVGANWIWGFLIGFFTPFITSA IGFSYGYVFMGCLVFSFFYVFFFVCETKGLTLEEVNEMYVEGVKPWKSGSWISKEKRVSE E
References
External Links
ResourceLink
Saccharomyces Genome Database HXT2
Uniprot IDP23585
Uniprot NameHXT2_YEAST
GenBank Gene IDM33270
Genebank Protein ID171743
General Reference
  • Kruckeberg, A. L., Bisson, L. F. (1990). "The HXT2 gene of Saccharomyces cerevisiae is required for high-affinity glucose transport." Mol Cell Biol 10:5903-5913.2233722
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956