You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAspartate aminotransferase, cytoplasmic
Synonyms
  • Transaminase A
Gene NameAAT2
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring nitrogenous groups
Specific FunctionPlays a key role in amino acid metabolism
Cellular LocationCytoplasm. Peroxisome.
SMPDB Pathways
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
Cysteine and methionine metabolismec00270 Map00270
Phenylalanine metabolismec00360 Map00360
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB ReactionsNot Available
KEGG Reactions
L-Aspartic acid + Oxoglutaric acidL-Glutamic acid + Oxalacetic acid
Oxoglutaric acid + erythro-4-hydroxy-L-glutamic acid4-hydroxy-2-oxoglutaric acid + L-Glutamic acid
L-Glutamic acid + (4-hydroxyphenyl)pyruvic acidL-Tyrosine + Oxoglutaric acid
Metabolites
YMDB IDNameView
YMDB00153Oxoglutaric acidShow
YMDB00235Oxalacetic acidShow
YMDB00271L-Glutamic acidShow
YMDB00364L-TyrosineShow
YMDB00719erythro-4-hydroxy-L-glutamic acidShow
YMDB007224-hydroxy-2-oxoglutaric acidShow
YMDB00896L-Aspartic acidShow
YMDB00958(4-hydroxyphenyl)pyruvic acidShow
GO Classification
Component
Not Available
Function
binding
transferase activity, transferring nitrogenous groups
transaminase activity
catalytic activity
cofactor binding
transferase activity
pyridoxal phosphate binding
Process
cellular amino acid metabolic process
metabolic process
biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR027C
Gene Sequence>1299 bp ATGAACAAAAGAACACAGGAATACAAGAACACAAGAGCGATAATGTCTGCCACTCTGTTC AATAACATCGAATTGCTGCCCCCTGATGCCCTTTTTGGTATTAAGCAAAGGTACGGGCAA GATCAACGTGCTACCAAGGTCGACTTGGGTATCGGGGCCTACAGAGACGACAACGGTAAA CCATGGGTCTTGCCAAGTGTTAAAGCCGCCGAAAAGCTAATTCATAACGACAGCTCCTAC AACCATGAATACCTCGGTATTACCGGTCTGCCAAGTTTGACATCTAACGCCGCCAAGATC ATCTTCGGTACGCAATCCGATGCCTTTCAGGAAGACAGAGTAATCTCAGTACAATCACTG TCTGGTACGGGTGCTCTTCATATATCTGCGAAGTTTTTTTCAAAATTCTTCCCAGATAAA CTGGTCTATTTGTCTAAGCCTACTTGGGCCAACCACATGGCCATTTTTGAGAATCAAGGC TTGAAAACGGCGACTTACCCTTACTGGGCCAACGAAACTAAGTCTTTGGACCTAAACGGC TTTCTAAATGCTATTCAAAAAGCTCCAGAGGGCTCCATTTTCGTTCTGCACTCTTGCGCC CATAACCCAACTGGTCTGGACCCTACTAGTGAACAATGGGTTCAAATCGTTGATGCTATC GCCTCAAAGAACCACATCGCCTTATTTGACACCGCCTACCAAGGGTTTGCCACTGGAGAT TTGGACAAGGATGCCTATGCTGTGCGTCTAGGTGTGGAGAAGCTTTCAACGGTCTCTCCC GTCTTTGTCTGTCAGTCCTTTGCCAAGAACGCCGGTATGTACGGTGAGCGTGTAGGTTGT TTCCATCTAGCACTTACAAAACAAGCTCAAAACAAAACTATAAAGCCTGCTGTTACATCT CAATTGGCCAAAATCATTCGTAGTGAAGTGTCCAACCCACCCGCCTACGGCGCTAAGATT GTCGCTAAACTGTTGGAAACGCCAGAATTAACGGAACAGTGGCACAAGGATATGGTTACC ATGTCCTCCAGAATTACGAAAATGAGGCACGCATTAAGAGACCATTTAGTCAAGTTGGGC ACTCCTGGCAACTGGGATCATATAGTAAATCAATGCGGGATGTTCTCCTTTACAGGATTG ACTCCTCAAATGGTTAAACGACTTGAAGAAACCCACGCAGTTTACTTGGTTGCCTCAGGT AGAGCTTCTATTGCTGGATTGAATCAAGGAAACGTGGAATACGTGGCTAAAGCCATTGAT GAAGTGGTGCGCTTCTATACTATTGAAGCTAAATTGTAA
Protein Properties
Pfam Domain Function
Protein Residues418
Protein Molecular Weight46057.30078
Protein Theoretical pI8.55
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aspartate aminotransferase, cytoplasmic MSATLFNNIELLPPDALFGIKQRYGQDQRATKVDLGIGAYRDDNGKPWVLPSVKAAEKLI HNDSSYNHEYLGITGLPSLTSNAAKIIFGTQSDAFQEDRVISVQSLSGTGALHISAKFFS KFFPDKLVYLSKPTWANHMAIFENQGLKTATYPYWANETKSLDLNGFLNAIQKAPEGSIF VLHSCAHNPTGLDPTSEQWVQIVDAIASKNHIALFDTAYQGFATGDLDKDAYAVRLGVEK LSTVSPVFVCQSFAKNAGMYGERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPP AYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVKLGTPGNWDHIVNQCGM FSFTGLTPQMVKRLEETHAVYLVASGRASIAGLNQGNVEYVAKAIDEVVRFYTIEAKL
References
External Links
ResourceLink
Saccharomyces Genome Database AAT2
Uniprot IDP23542
Uniprot NameAATC_YEAST
GenBank Gene IDZ73199
Genebank Protein ID1360338
PDB ID
1YAA
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Cronin, V. B., Doyle, J. M., Doonan, S. (1990). "Amino acid sequences of aspartate aminotransferases: the cytosolic isoenzymes from yeast and from human liver." Biochem Soc Trans 18:256.2199266
  • Cronin, V. B., Maras, B., Barra, D., Doonan, S. (1991). "The amino acid sequence of the aspartate aminotransferase from baker's yeast (Saccharomyces cerevisiae)." Biochem J 277 ( Pt 2):335-340.1859361
  • Yagi, T., Kagamiyama, H., Nozaki, M. (1982). "Aspartate: 2-oxoglutarate aminotransferase from bakers' yeast: crystallization and characterization." J Biochem 92:35-43.6811576
  • Verleur, N., Elgersma, Y., Van Roermund, C. W., Tabak, H. F., Wanders, R. J. (1997). "Cytosolic aspartate aminotransferase encoded by the AAT2 gene is targeted to the peroxisomes in oleate-grown Saccharomyces cerevisiae." Eur J Biochem 247:972-980.9288922
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Jeffery, C. J., Barry, T., Doonan, S., Petsko, G. A., Ringe, D. (1998). "Crystal structure of Saccharomyces cerevisiae cytosolic aspartate aminotransferase." Protein Sci 7:1380-1387.9655342