You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydrosphingosine 1-phosphate phosphatase YSR3
Synonyms
  • Long-chain base protein 2
  • Sphingolipid resistance protein 3
Gene NameYSR3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionDihydrosphingosine 1-phosphate phosphatase required for efficient ceramide synthesis from exogenous sphingoid bases. Involved in endocytosis and calcium-mediated signaling
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Phytosphingosine 1-phosphate + waterPhytosphingosine + phosphate
water + Sphinganine 1-phosphateSphinganine + phosphate
Metabolites
YMDB IDNameView
YMDB00285PhytosphingosineShow
YMDB00299Sphinganine 1-phosphateShow
YMDB00327SphinganineShow
YMDB00762Phytosphingosine 1-phosphateShow
YMDB00890waterShow
GO Classification
Component
membrane
cell part
Function
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 11
LocusYKR053C
Gene Sequence>1215 bp ATGACCATTATTCAGACGGTTACTGAATTGGGTGTTACCGAGGACACCATTAAGGTTCAG ATGGCTCCTTCCGGCGGCAAACACCTATTGGCAGATCCCGGTAATCATCCAGCGGAGCAT TTTGAGAGCCAGATGTCGTGGCTAAGGTTTCAAACAAGGCAGTATCTAACTAGATTCACA GACAACCAATCAGATTTCGTACATTCTTTACAAAAAAAGCACAGAACGCCTTTTAGAGAC GTTTATTTCAAATACACTTCGCTTATGGGTTCCCACATGTTTTATGTTATCGTGCTTCCC ATGCCTGTGTGGCTTGGATACCGCGATTTAACACGGGACATGATCTACGTTCTTGGTTAT TCAATTTATTTGAGTGGCTACTTAAAGGATTATTGGTGCCTACCAAGGCCAAAATCACCG CCAGTTGACAGAATCACACTAAGTGAATACACTACGAAAGAATATGGTGCACCCAGTTCA CATTCTGCTAACGCTACTGCGGTAAGTCTATTATTCTTTTGGAGAATATGTTTATCTGAC ACACTGGTATGGCCAACAAAGCTTCTTTTACTGAGTCTGGTGATATTTTACTACTTAACC CTGGTTTTTGGTAGAGTTTACTGCGGTATGCATGGTATGCTGGATTTATTTAGCGGCGCC GCAGTTGGAGCTATCTGTTTTTTTATAAGAATCTGGGTGGTGCATGCTTTACGAAATTTC CAGATTGGTGAACATCTCTGGTTTCCCCTTTTGAGTGTAGCATGGGGCTTGTTTATTCTG TTTAACCACGTCAGGCCCATTGATGAATGTCCTTGTTTCGAAGATAGCGTAGCGTTCATT GGCGTAGTCAGTGGGCTGGATTGCAGCGACTGGTTAACCGAAAGATACGGATGGAACCTT GTATGTAGTAGGTACGCATCATGTGGTTCTAAGGTGTTCTTGAGGCCTCTGGTAGGTGTC GCTTCTGTGATTGTTTGGAAAGACGTCATTAGCAAGACAGCTGTCTACACGCTGTTAATT AAACTACTCAGATTTCACGATGATAGAAGCGAAAAGGTTCATTTCCATAACGAGACAAGT GAAGAAGAAGAGTGTTTATTGTACAGCGGTGTTTCCAAAGTGGAAATCGTCGGAAGGTTT CTCATATACGCAGGTATACCTACAACCGTCTTTTTGCTATGCCCAGTTTTTTTCACTTGG ACAAACTTAAGGTAG
Protein Properties
Pfam Domain Function
Protein Residues404
Protein Molecular Weight46487.69922
Protein Theoretical pI7.73
Signalling Regions
  • None
Transmembrane Regions
  • 87-107
  • 114-134
  • 155-176
  • 183-203
  • 216-236
  • 242-262
  • 320-340
  • 380-400
Protein Sequence>Dihydrosphingosine 1-phosphate phosphatase YSR3 MTIIQTVTELGVTEDTIKVQMAPSGGKHLLADPGNHPAEHFESQMSWLRFQTRQYLTRFT DNQSDFVHSLQKKHRTPFRDVYFKYTSLMGSHMFYVIVLPMPVWLGYRDLTRDMIYVLGY SIYLSGYLKDYWCLPRPKSPPVDRITLSEYTTKEYGAPSSHSANATAVSLLFFWRICLSD TLVWPTKLLLLSLVIFYYLTLVFGRVYCGMHGMLDLFSGAAVGAICFFIRIWVVHALRNF QIGEHLWFPLLSVAWGLFILFNHVRPIDECPCFEDSVAFIGVVSGLDCSDWLTERYGWNL VCSRYASCGSKVFLRPLVGVASVIVWKDVISKTAVYTLLIKLLRFHDDRSEKVHFHNETS EEEECLLYSGVSKVEIVGRFLIYAGIPTTVFLLCPVFFTWTNLR
References
External Links
ResourceLink
Saccharomyces Genome Database YSR3
Uniprot IDP23501
Uniprot NameDS1P2_YEAST
GenBank Gene IDZ28278
Genebank Protein ID486509
General Reference
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Wiesenberger, G., Link, T. A., von Ahsen, U., Waldherr, M., Schweyen, R. J. (1991). "MRS3 and MRS4, two suppressors of mtRNA splicing defects in yeast, are new members of the mitochondrial carrier family." J Mol Biol 217:23-37.1703236
  • Mao, C., Wadleigh, M., Jenkins, G. M., Hannun, Y. A., Obeid, L. M. (1997). "Identification and characterization of Saccharomyces cerevisiae dihydrosphingosine-1-phosphate phosphatase." J Biol Chem 272:28690-28694.9353337
  • Mandala, S. M., Thornton, R., Tu, Z., Kurtz, M. B., Nickels, J., Broach, J., Menzeleev, R., Spiegel, S. (1998). "Sphingoid base 1-phosphate phosphatase: a key regulator of sphingolipid metabolism and stress response." Proc Natl Acad Sci U S A 95:150-155.9419344
  • Mao, C., Saba, J. D., Obeid, L. M. (1999). "The dihydrosphingosine-1-phosphate phosphatases of Saccharomyces cerevisiae are important regulators of cell proliferation and heat stress responses." Biochem J 342 Pt 3:667-675.10477278
  • Zanolari, B., Friant, S., Funato, K., Sutterlin, C., Stevenson, B. J., Riezman, H. (2000). "Sphingoid base synthesis requirement for endocytosis in Saccharomyces cerevisiae." EMBO J 19:2824-2833.10856228
  • Mao, C., Obeid, L. M. (2000). "Yeast sphingosine-1-phosphate phosphatases: assay, expression, deletion, purification, and cellular localization by GFP tagging." Methods Enzymol 311:223-232.10563329