You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN-alpha-acetyltransferase 38, NatC auxiliary subunit
Synonyms
  • L-A virus GAG protein N-acetyltransferase subunit MAK31
  • Maintenance of killer protein 31
  • N-terminal acetyltransferase C complex subunit MAK31
  • NatC complex subunit MAK31
Gene NameMAK31
Enzyme ClassNot Available
Biological Properties
General FunctionTranscription
Specific FunctionComponent of the NatC N-terminal acetyltransferase, which catalyzes acetylation of the N-terminus Met of L-A virus Gag protein. MAK31 is necessary for the structural stability of L-A double-stranded RNA-containing particles. Necessary for growth at 37 degrees Celsius as well as for maintenance of the killer plasmid
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 3
LocusYCR020C-A
Gene Sequence>267 bp ATGGACATCTTGAAACTGTCAGATTTTATTGGAAATACTTTAATAGTTTCCCTTACAGAA GATCGTATTTTAGTTGGAAGCTTGGTTGCTGTAGATGCCCAAATGAATTTGCTATTAGAT CATGTTGAGGAACGTATGGGCTCCAGTAGTAGAATGATGGGCCTAGTCAGCGTCCCTAGG CGTTCCGTTAAGACCATAATGATTGATAAGCCTGTTCTGCAGGAGCTTACTGCGAATAAA GTTGAATTGATGGCTAATATTGTTTAG
Protein Properties
Pfam Domain Function
Protein Residues88
Protein Molecular Weight9724.5
Protein Theoretical pI5.0
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N-alpha-acetyltransferase 38, NatC auxiliary subunit MDILKLSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERMGSSSRMMGLVSVPR RSVKTIMIDKPVLQELTANKVELMANIV
References
External Links
ResourceLink
Saccharomyces Genome Database MAK31
Uniprot IDP23059
Uniprot NameNAA38_YEAST
GenBank Gene IDAY558148
Genebank Protein ID45270186
General Reference
  • Toh-e, A., Sahashi, Y. (1985). "The PET18 locus of Saccharomyces cerevisiae: a complex locus containing multiple genes." Yeast 1:159-171.3916862
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Polevoda, B., Sherman, F. (2001). "NatC Nalpha-terminal acetyltransferase of yeast contains three subunits, Mak3p, Mak10p, and Mak31p." J Biol Chem 276:20154-20159.11274203
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106