You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-mannosidase
Synonyms
  • Alpha-D-mannoside mannohydrolase
Gene NameAMS1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionDegrades free oligosaccharides in the vacuole
Cellular LocationVacuole.
SMPDB PathwaysNot Available
KEGG Pathways
Other glycan degradationec00511 Map00511
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00846Alpha-D-MannoseShow
YMDB00866MannotetraoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
alpha-mannosidase activity
mannosidase activity
ion binding
cation binding
metal ion binding
transition metal ion binding
zinc ion binding
hydrolase activity
hydrolase activity, acting on glycosyl bonds
catalytic activity
hydrolase activity, hydrolyzing O-glycosyl compounds
Process
mannose metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL156W
Gene Sequence>3252 bp ATGTCATCTGAGGATATCATTTATGATCCTCAGTTCAAACCTGTTCAGGGAATCTACGAG AATAGATTAAGACAATTTATTGATACTGGTGGGGATTACCATGACTTAAATTTACCCAAG TTTTATGATAAGAAGCGCATTTCATTAGATCATGATCACGTTAAGGTTTGGTGGTACCAG GTTTCTTTTGAACGTGGATCTTCCCCTGTTTCCCCTGATAAGAGGCCATCTTGGAAATCT ATTATTGAACGTGACAAGAAGGGTGAATTGGAGTTTAGAGAAGCGAACATAAATCAGCCC TTTGGACCCAGTTGGTCTACCACTTGGTTCAAGGTGAAAATCTCTTTGCCTGAAGATTGG GTTAAATCAAACGAGCAACTACTTTTCCAATGGGATTGTTCTAACGAAGGAATTGTCATA GACCCAAAGACTCTAATCCCTGTGACTGCTTTTTCAGGTGGTGAAAGGACTGAATATGTT TTACCGAAAACATCGGATGGGAAACATTTCTTTTACATCGAAGCTGGTAATAATGGTATG TTTGGCTGCGGTGCAGGATCCACTATAAATCCACCAGATGATAATAGATTTTTTCATTTG AGAAAAGCTGATATCGTTTGGCCCGATCTAGATGCTCGTGCATTGTATATCGATTTTTGG ATGCTAGGGGATGCTGCAAGAGAGCTACCTGGAGACTCCTGGCAAAAACACCAGGCAAGA CAACTAGGCAATGCAGTTATGAATCTTTTTGACCCGAATGATCGTTCAAGTGTTCGTAAA TGTCGTGAATTACTACAAAGGGAATACTTTGACTCCTTTTTAGAAAGCAGTAAGGTTTAC GAACAAGGTGAATCTCAAGTTTTAACAAATGTTTATGGTATCGGCAACTGTCATATAGAT ACAGCTTGGCTATGGCCATTCGCAGAAACAAGAAGGAAAATTGTGAGATCTTGGTCTTCC CAATGTACTTTAATGGATCGCTTCCCAGAGTATAAATTTGTTGCTTCACAAGCCCAACAA TTTAAATGGTTATTAGAAGATCATCCCGAATTTTTCAATAAAGTGTTAATTCCAAAAATT CAGCAATCTCAGTTTTTTGCTGTTGGTGGTACATGGGTTGAGAATGATACCAATATTCCC TCAGGGGAATCGCTGGCAAGGCAATTCTTTTTTGGTCAAAGGTTTTTCTTGAAGCATTTT GGTCTCAAGTCAAAGATATTTTGGTTACCTGACACCTTTGGTTATTCTTCGCAAATGCCA CAACTTTGCCGCTTATCTGGTATTGATAAATTTTTGACTCAAAAGCTTTCCTGGAATAAC ATCAACAGTTTTCCGCATAGCACGTTTAACTGGGCAGGGATTGACGGTTCTCAATTATTG ACTCACATGCCTCCTGGTAATACGTATACAGCAGATTCACACTTCGGTGATGTTTTGCGT ACTGCCAAGCAGAATAAGACACCAGAATATTACGGCTCCGGTTTAATGTTGTACGGAAAG GGTGATGGTGGTGGAGGACCAACTGAGGAAATGCTGCAAAAAATGAGGCGTATTAGATCC ATGAATAACAGAAATGGTAATGTTATTCCAAAGTTACAAGTTGGTATAACGGTTGATGAA TTTTATGATGACATTTTGAAAAGGACTAACCAAGGCCATGATTTACCCACATGGAGTGGT GAATTGTATTTCGAATTTCATAGGGGGACATACACCAGTCAAGCTCAGACCAAAAAATTA ATGAGGTTGTCCGAAATTAAACTACATGATTTGGAATGGATAGCTGCCAAAACATCAGTT TTATATCCCGATTCGTATAAATACCCTTCCAAACAGATTAACGAACTTTGGGAGAATGTT TTGTTATGTCAATTTCACGATGTTCTACCAGGATCATGTATTGAAATGGTATATAAGTAT GAGGCTGTCCCTATGTTGCACAACGTTGTGAAAGAATGTACTTCCTTAATAGACAAAACC GTTCAATTTCTTCAGAGTCAGAGTAAGGCAGATTTGGTTGAGATGAGAACATTAACTTGG TCAAAACCAGAAAAGGTTTCTGAGGAGTGCTCGTTGAACGGTAGTTACACGTCCTCTGTA ACCGGGTACGATGACTATATAGTCCTTGCCAATGGGAAGTTGAAAGTTATCATTTGCAAA AAGACTGGGGTGATCACAAGCATTACGGATGAAACTTTGGGGGTAGAATACCTGGACACG GAACATGGCAGAAACAAATTGGGCGCCAACCAGTTTGTTATTTATGATGATAAACCTTTG GGCTGGCAGGCTTGGGATACTGAACTTTATTCCGTCAACCAATACAAGTATGTAACAAAG CCGAAGAAAGTTCAACTTTCCTGCAACACAAAAGAGAAATGTGCTGTTGAGGCTATTTTT CAAATTTCCGAAAAATGCAAAATCAAATCAGTGATATCACTCAATGCAACTGCGGTCACT GATGCTAAATTAAGTAAAGTAGACATTTCTACGACGGTAGAAAACTGGGATGCTAGAAAC AAATTTTTAAAAGTTGAATTTCCCGTTAATATTCGGAACGATTTTGCTTCGTATGAAACT CAATTCGGGATTACCAAAAGACCAACACATTATAATACCTCATGGGACGTCGCTAAATTT GAGGTTTGCCATCACAAATTTGCTGATTATTCTGAATACAGCAAGGGTGTTTCAATTTTG AACGATTGCAAATATGGGTTTTCCACACACGGTAACTTGATGAGATTATCATTATTAAGG TCACCAAAGGCTCCGGATGCGCATGCTGATATGGGTACTCATGAGATAAAATATGCTATC TATCCACATAGAGGAGCACTATCAAGCGACACTGTTAAGCTCGCTCACGAATTCAATTAT TGCTTCAAATACAAACTCCCCAAAGATATTGGCATGAATTTTGATGACATCATAAGCATT TCCGGAGATGAGAATGTCATTTTGTCTAACATAAAAAGAGGCGAAGATGATAGTGCTGTC AAGTCCAACTATTCATTAAATCCAAGGGATGAACAAAGTATTGTGGTAAGGGTTTACGAA TCTCTTGGCGGGGAATCTTTTGCTTCACTAAATACCACACTAAATTTGAAGCGTATTGAG AAGGTCGATAACTTGGAGATGAAAGTTTATAAGAGTTTGACAGCAACGCGAGACGAATCA AATCATGCAATAAACAGAATTCCCATTAAATTGAGACCTTTTGAGATTGCCTCATTCAGG TTGTATTTCTGA
Protein Properties
Pfam Domain Function
Protein Residues1083
Protein Molecular Weight124498.0
Protein Theoretical pI7.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alpha-mannosidase MSSEDIIYDPQFKPVQGIYENRLRQFIDTGGDYHDLNLPKFYDKKRISLDHDHVKVWWYQ VSFERGSSPVSPDKRPSWKSIIERDKKGELEFREANINQPFGPSWSTTWFKVKISLPEDW VKSNEQLLFQWDCSNEGIVIDPKTLIPVTAFSGGERTEYVLPKTSDGKHFFYIEAGNNGM FGCGAGSTINPPDDNRFFHLRKADIVWPDLDARALYIDFWMLGDAARELPGDSWQKHQAR QLGNAVMNLFDPNDRSSVRKCRELLQREYFDSFLESSKVYEQGESQVLTNVYGIGNCHID TAWLWPFAETRRKIVRSWSSQCTLMDRFPEYKFVASQAQQFKWLLEDHPEFFNKVLIPKI QQSQFFAVGGTWVENDTNIPSGESLARQFFFGQRFFLKHFGLKSKIFWLPDTFGYSSQMP QLCRLSGIDKFLTQKLSWNNINSFPHSTFNWAGIDGSQLLTHMPPGNTYTADSHFGDVLR TAKQNKTPEYYGSGLMLYGKGDGGGGPTEEMLQKMRRIRSMNNRNGNVIPKLQVGITVDE FYDDILKRTNQGHDLPTWSGELYFEFHRGTYTSQAQTKKLMRLSEIKLHDLEWIAAKTSV LYPDSYKYPSKQINELWENVLLCQFHDVLPGSCIEMVYKYEAVPMLHNVVKECTSLIDKT VQFLQSQSKADLVEMRTLTWSKPEKVSEECSLNGSYTSSVTGYDDYIVLANGKLKVIICK KTGVITSITDETLGVEYLDTEHGRNKLGANQFVIYDDKPLGWQAWDTELYSVNQYKYVTK PKKVQVSCNTKEKCAVEVIFQISEKCKIKSVISLNATAVTDAKLSKVDISTTVENWDARN KFLKVEFPVNIRNDFASYETQFGITKRPTHYNTSWDVAKFEVCHHKFADYSEYSKGVSIL NDCKYGFSTHGNLMRLSLLRSPKAPDAHADMGTHEIKYAIYPHRGALSSDTVKLAHEFNY CFKYKLPKDIGMNFDDIISISGDENVILSNIKRGEDDSAVKSNYSLNPRDEQSIVVRVYE SLGGESFASLNTTLNLKRIEKVDNLEMKVYKSLTATRDESNHAINRIPIKLRPFEIASFR LYF
References
External Links
ResourceLink
Saccharomyces Genome Database AMS1
Uniprot IDP22855
Uniprot NameMAN1_YEAST
GenBank Gene IDM29146
Genebank Protein ID171058
General Reference
  • Yoshihisa, T., Anraku, Y. (1989). "Nucleotide sequence of AMS1, the structure gene of vacuolar alpha-mannosidase of Saccharomyces cerevisiae." Biochem Biophys Res Commun 163:908-915.2675832
  • James, C. M., Indge, K. J., Oliver, S. G. (1995). "DNA sequence analysis of a 35 kb segment from Saccharomyces cerevisiae chromosome VII reveals 19 open reading frames including RAD54, ACE1/CUP2, PMR1, RCK1, AMS1 and CAL1/CDC43." Yeast 11:1413-1419.8585324
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Yoshihisa, T., Anraku, Y. (1990). "A novel pathway of import of alpha-mannosidase, a marker enzyme of vacuolar membrane, in Saccharomyces cerevisiae." J Biol Chem 265:22418-22425.2266133
  • Hutchins, M. U., Klionsky, D. J. (2001). "Vacuolar localization of oligomeric alpha-mannosidase requires the cytoplasm to vacuole targeting and autophagy pathway components in Saccharomyces cerevisiae." J Biol Chem 276:20491-20498.11264288
  • Chantret, I., Frenoy, J. P., Moore, S. E. (2003). "Free-oligosaccharide control in the yeast Saccharomyces cerevisiae: roles for peptide:N-glycanase (Png1p) and vacuolar mannosidase (Ams1p)." Biochem J 373:901-908.12723970
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106