You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethionyl-tRNA synthetase, mitochondrial
Synonyms
  • Methionine--tRNA ligase
  • MetRS
Gene NameMSM1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-methionine + tRNA(Met) = AMP + diphosphate + L-methionyl-tRNA(Met)
Cellular LocationMitochondrion matrix
SMPDB Pathways
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Selenocompound metabolismec00450 Map00450
SMPDB Reactions
Adenosine triphosphate + tRNA(Met) + SelenomethionineAdenosine monophosphate + Pyrophosphate + Selenomethionyl-tRNA(Met)
KEGG Reactions
L-Methionine + tRNA(Met) + Adenosine triphosphateAdenosine monophosphate + Pyrophosphate + Met-tRNA(Met)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00318L-MethionineShow
YMDB16175SelenomethionineShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
methionine-tRNA ligase activity
binding
nucleotide binding
Process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
macromolecule metabolic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
biosynthetic process
methionyl-tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 7
LocusYGR171C
Gene Sequence>1728 bp ATGCAATGTCGATCAATTGTGCATCGTCTGTACTCTAAGATCTCCCACGTAACGACGCCA ATTTTCTATCCCAATGCCAAACCGCACCTCGGCCATCTTTACTCCAGCTTATTAAGTGAC GTTTACCATCGATGGCAATTATTTAAAGGTAATCTATCCTTCTTTACCACAGGTACTGAT GAACATGGATTGAAAATCCAGTGTGCTAGTGAAAGCAATGGCTTCGATCAGCCAAAAAAG TTCGTCGATAAGCTATACCCAGAGTTTGTTCAATTAGACAAAATATATGGCATTAATTAT ACAAGATTTATAAGGACTACGGATCCTGACCACATTGAAAACGTGATGAAATTATGGGAA CTTTGTTTGAAAAATGGCTATATTTACATGGGCGAACATAAGGGTTGGTATTCCATTTCT GATGAAACATTCTATCCTGAATCCAAGGTTATTAAAGACCCCAAAAATGATGGTAAGTAT CTGAATACAGAATCGAAAAACGAAGTAGTTTATCAGTCAGAGACAAATTACTTCTTTAGG CTATCCTTATTTAACAAGAAAATAGTTGACCATATAAGAAAGAATCCAGATTTCATTTTT CCTGCTTCTAAAAGAGACCAAATTCTAAAAGAACTAGAAACCGGTGGGACATTGCCAGAT TTATCGATATCGAGACCCTCTGCGAGACTTAAATGGGGTATACCGACTCCTAATGATCCG TCCCAAAAAGTTTATGTGTGGTTTGATGCCTTGTGTAACTACCTCTCCTCCATCGGTGGC ATACCGTCCATCTTGAGTAATGCTACTGAAGTAGTTTCAAGACATTATAGCGACAAATCA AACGTAAAAGGCCAATTGTTAATACCATACCCAAAAGAAGTGCAGCGAAACACCATTCAC GTGATAGGAAAGGATATCGCGAAATTCCATACCGTATATTGGCCTTCTTTTTTACTGGCT GCTGGACTGCCTTTACCAAGACAAATTGTTGTTCATGGACACTGGCTCTGCAATGGAATG AAAATGTCCAAAAGTTTGGGTAATGTTGTAGATCCGATTGATATGGCACGTTATTATGGA GCCGATATTGTGCGTTGGTTCTTGTTAGAAAATTCTAAACTGGAAGAGGACGGCGATTTT CAAGAAGCCAAATTATACGAGACAAGAGAGCTTTTAGTATCCAAATGGGGCAATCTGATT AACAGATGTTGTGGCTCGAAATTCAATATTGAAAGAGCTGTTATGAAATTTAGCGACAAG GCAAATTTTCAATTTCAGGAGATTTTCCAAAATGAACCAATAGTCTCCGAACGAATTGAG AATCTGGCTAAACTACTCAACAAATCACAAGAGGTTTTTGACGAAAAAATAGCCATATTC CAGTATCCTCAACTGCTAAGGCATGTTTGGAGTATTATCAACGATGCAAATACTTTGGTT CAAAATAGTAAACCTTGGGAGAGGGAATTAGATCAACAAGACAATATAATATTTTTGGCT ATGGAAACGTCTAGAATCCTCTCCATTTTATGCCAATCCATTATACCATCTCTCTCACAA AGTTTCCTAGATCGTATTGATGTTTCAAAGGAGAAAAGGACTATAAATTATGCTAGATTG GGTTCCGATAAAACATATGGAAAGCAATCTAACAAGAAAGGCCGAGAAGTACCTTTGAAA AAAATTCCATTCAGGTTGCAAGAGGAACAAACGAATATGAGGTCATGA
Protein Properties
Pfam Domain Function
Protein Residues575
Protein Molecular Weight66733.89844
Protein Theoretical pI9.07
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methionyl-tRNA synthetase, mitochondrial MQCRSIVHRLYSKVSHVTTPIFYPNAKPHLGHLYSSLLSDVYHRWQLFKGNLSFFTTGTD EHGLKIQCASESNGFDQPKKFVDKLYPEFVQLDKIYGINYTRFIRTTDPDHIENVMKLWE LCLKNGYIYMGEHKGWYSISDETFYPESKVIKDPKNDGKYLNTESKNEVVYQSETNYFFR LSLFNKKIVDHIRKNPDFIFPASKRDQILKELETGGTLPDLSISRPSARLKWGIPTPNDP SQKVYVWFDALCNYLSSIGGIPSILSNATEVVSRHYSDKSNVKGQLLIPYPKEVQRNTIH VIGKDIAKFHTVYWPSFLLAAGLPLPRQIVVHGHWLCNGMKMSKSLGNVVDPIDMARYYG ADIVRWFLLENSKLEEDGDFQEAKLYETRELLVSKWGNLINRCCGSKFNIERAVMKFSDK ANFQFQEIFQNEPIVSERIENLAKLLNKSQEVFDEKIAIFQYPQLLRHVWSIINDANTLV QNSKPWERELDQQDNIIFLAMETSRILSILCQSIIPSLSQSFLDRIDVSKEKRTINYARL GSDKTYGKQSNKKGREVPLKKIPFRLQEEQTNMRS
References
External Links
ResourceLink
Saccharomyces Genome Database MSM1
Uniprot IDP22438
Uniprot NameSYMM_YEAST
GenBank Gene IDX14629
Genebank Protein ID3998
General Reference
  • Tzagoloff, A., Vambutas, A., Akai, A. (1989). "Characterization of MSM1, the structural gene for yeast mitochondrial methionyl-tRNA synthetase." Eur J Biochem 179:365-371.2645139
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106