You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3',5'-cyclic-nucleotide phosphodiesterase 1
Synonyms
  • PDEase 1
  • 3':5'-CNP
  • Low-affinity cAMP phosphodiesterase
Gene NamePDE1
Enzyme Class
Biological Properties
General FunctionInvolved in 3',5'-cyclic-AMP phosphodiesterase activity
Specific FunctionControls the level of cAMP in yeast cells, together with the high-affinity cAMP phosphodiesterase (PDE2)
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
3',5'-cyclic AMP + waterAdenosine monophosphate + hydron
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
3',5'-cyclic-nucleotide phosphodiesterase activity
3',5'-cyclic-AMP phosphodiesterase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
cyclic-nucleotide phosphodiesterase activity
Process
purine nucleotide catabolic process
metabolic process
cAMP catabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL248W
Gene Sequence>1110 bp ATGGTTGTATTCGAAATAACTATACTTGGGGCCAATGGAGGACCCACCGAATACGGAACA CAGTGTTTTATACTTAAGCCTGCTAGAACAGAGGATCCAGAATTAATAGCTGTAGACGGT GGTGCAGGAATGTACCAGCTACGGGAGATGTTGGTCCAAGGGCGAAATGAAAATGAAGGT GATGATGAGCTTGTTCCAAGCTTTTATGAACATGATCGAGAGCCAATAGAGTTTTTTATT GATTCCAAACTGAACATACAAAAGGGATTATCCAAGTCCTTCCTACAATCATTAAAGAGG CAGGGAGAGCATTTTGAAAGCGCCAATACAATGAAGAAAACTTACGAGGTTTTCCAAGGA ATTACCGACTACTACATTACCCATCCCCATCTGGACCATATTAGTGGGCTGGTAGTAAAC TCCCCCTCAATATATGAGCAGGAAAACAGTAAAAAGAAAACTATTTGGGGATTACCGCAT ACTATTGACGTTTTGCAAAAGCATGTCTTTAATGACTTAATATGGCCAGATTTAACGGCA GAACGTTCAAGAAAATTGAAGCTAAAATGCTTGAATCCGAAGGAAGTTCAAAAGTGCACT ATCTTTCCTTGGGATGTAATACCGTTCAAAGTTCATCATGGGATAGGCGTCAAGACTGGC GCGCCGGTATACAGCACCTTCTATATCTTCAGAGACAGGAAAAGCAAAGACTGTATAATA GTTTGCGGAGATGTTGAGCAGGACCGCAGAGAATCTGAAGAATCTCTACTTGAAGAATTT TGGTCTTACGTTGCTGAAAATATACCGCTTGTGCATCTCAAGGGTATATTAGTCGAATGT TCATGCCCATTATCTTCCAAGCCCGAGCAATTGTATGGTCATCTATCTCCAATATATTTA ATCAACGAATTATCCAATTTGAACACTTTATACAACAGTAGTAAGGGATTAAGCGGTTTG AATGTTATCGTTACTCACGTTAAGTCAACACCTGCTAAAAGAGACCCAAGACTAACCATA CTCGAAGAGTTACGATTTTTAGCTGAGGAGAGGAACTTAGGAGACTTGAGAATATCTATT GCGCTAGAAGGCCACACTTTGTTTCTATAA
Protein Properties
Pfam Domain Function
Protein Residues369
Protein Molecular Weight42015.69922
Protein Theoretical pI6.06
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3',5'-cyclic-nucleotide phosphodiesterase 1 MVVFEITILGANGGPTEYGTQCFILKPARTEDPELIAVDGGAGMYQLREMLVQGRNENEG DDELVPSFYEHDREPIEFFIDSKLNIQKGLSKSLLQSLKRQGEHFESANTMKKTYEVFQG ITDYYITHPHLDHISGLVVNSPSIYEQENSKKKTIWGLPHTIDVLQKHVFNDLIWPDLTA ERSRKLKLKCLNPKEVQKCTIFPWDVIPFKVHHGIGVKTGAPVYSTFYIFRDRKSKDCII VCGDVEQDRRESEESLLEEFWSYVAENIPLVHLKGILVECSCPLSSKPEQLYGHLSPIYL INELSNLNTLYNSSKGLSGLNVIVTHVKSTPAKRDPRLTILEELRFLAEERNLGDLRISI ALEGHTLFL
References
External Links
ResourceLink
Saccharomyces Genome Database PDE1
Uniprot IDP22434
Uniprot NamePDE1_YEAST
GenBank Gene IDM17781
Genebank Protein ID172229
General Reference
  • Nikawa, J., Sass, P., Wigler, M. (1987). "Cloning and characterization of the low-affinity cyclic AMP phosphodiesterase gene of Saccharomyces cerevisiae." Mol Cell Biol 7:3629-3636.2824992
  • Coissac, E., Maillier, E., Robineau, S., Netter, P. (1996). "Sequence of a 39,411 bp DNA fragment covering the left end of chromosome VII of Saccharomyces cerevisiae." Yeast 12:1555-1562.8972578
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956