You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAldehyde dehydrogenase 1, mitochondrial
SynonymsNot Available
Gene NameALD1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionAn aldehyde + NAD(+) + H(2)O = an acid + NADH
Cellular LocationMitochondrion matrix
SMPDB Pathways
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Fatty acid metabolismec00071 Map00071
Glycerolipid metabolismec00561 Map00561
Glycolysis / Gluconeogenesisec00010 Map00010
Histidine metabolismec00340 Map00340
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1602 bp ATGTTGGCTACAAGAAACTTGGTGCCGATTATACGTGCTTCGATAAAATGGAGAATTAAG TTGTCTGCTTTACACTACTGTATGTCCGACGCAGAAACATCTGAGGCACTCTTAGAGGAC AACTCTGCATACATCAATAACGAAAAGCACAATCTATTTCTGGAAAAGATTTTTTCGGAC TACCAGCCGTTTAAACACGACAATCGGACACAAGTTTCTTGTAGCCAACATATGAGAGAT TATCGCCCTCTGCTGACACTTAGTTCCGCAACTAGATCAGTGTTGTTTTCACTTCTTGCC TCAGATATGTCAATAATACTTTCCATTTCACCTAATACTGGTATATTGTTGTGTATAGGT CATCTACTAGCCTCAGATATAGAAGACGTCGTCATAGTCCTATCTAGAGGTTCCCCGCTA GTAGACCTAGCCTCCACGCGCATATTCAAACTTGCTCAAAACGGTACCCTAAGATTTGCC ATTAAGCGAACAACATTCCAAGAGCTGAGATTTTTACGAAAGTCAAAGGACGAAAACGTC ATGGAGGCCGCCACAAGAGGTATAATAACTATAAGGCAGCTTTACTATGAGAATAAAGTA TTACCCCTAAGATTCACAGGTAATGTAGCGACACACATCGAAGAGAACTTAGAATTTGAA GAACAAATAACATGGAGAACACATGTCGACTCTTCTATTTTTCCCAATACTAGATGTGCC TACCCATCTGGTTACGGTCCAAGTGCCAAGATTCCATGTTTGTCTCATAAGCCAAACGAC ATTCTGGCCTACACAGGTTCGACTTTAGTTGGTCGAGTAGTATCTAAATTGGCACCTGAA CAAGTCATGAAGAAGGTAACTTTGGAATCTGGTGGTAAATCTACAATGGCTGTATTCATC CAACACGACGTCACATGGGCAGTTGAAAACACACAATTTGGCGTCTTCGATAGACAGGGT CAATGTTGTATCGCTCAATCTGGTTACACTGTACATAGGTCTACACTATCCCAAATTGTA GAAAATAATTTGGAAAAAGATCCTTCTTACGTACTACATGTAGATACCGAATCCGACATA AGGGGTCCTTTTATACTAAAAATACACTTCGAATCTATACCTAGACGAATCAATTCTGCA AAAGCAGAAAATTCTAAAGTACTATGCGGTGGTCCTAGGGAAAACTCTGTATACCTATAC CCTACACTATCTGCAACACTAACAGACGAATGCAGAATCATGAAAGAAGAAGTCTTTGCC CCGATTATTACAATTTTATGCGTCAAAACTGTCGACGAGGCCATTCAACGGGGCAACAAC TCTAAGTTTGGATTAGCTGCTTACGTCACTAAGGAAAACGTCCACGGTATTATTTTATCT ACAGCCTTAAAAACAGTTAAATTGTTTATTATTTGCGTGCACTTGGCGTCTTACCAAATT CCCTTTGGGGGCAACAAAAACTCAGGTATGGGTGCGGAACTGGGAAAGCGTGCGCTGGAA AATTACACAGAAGGCAATCACGTGTTGCCCGTCTCACTGGTGAAAGAAACCCTGGCGCCC AATACCGAAACCGCCTCTCCCGCGCGTTGGCCGATTCATTAA
Protein Properties
Pfam Domain Function
Protein Residues533
Protein Molecular Weight59506.80078
Protein Theoretical pI8.34
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aldehyde dehydrogenase 1, mitochondrial MLATRNLVPIIRASIKWRIKLSALHYCMSDAETSEALLEDNSAYINNEKHNLFLEKIFSD YQPFKHDNRTQVSCSQHMRDYRPLLTLSSATRSVLFSLLASDMSIILSISPNTGILLCIG HLLASDIEDVVIVLSRGSPLVDLASTRIFKLAQNGTLRFAIKRTTFQELRFLRKSKDENV MEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDSSIFPNTRCA YPSGYGPSAKIPCLSHKPNDILAYTGSTLVGRVVSKLAPEQVMKKVTLESGGKSTMAVFI QHDVTWAVENTQFGVFDRQGQCCIAQSGYTVHRSTLSQIVENNLEKDPSYVLHVDTESDI RGPFILKIHFESIPRRINSAKAENSKVLCGGPRENSVYLYPTLSATLTDECRIMKEEVFA PIITILCVKTVDEAIQRGNNSKFGLAAYVTKENVHGIILSTALKTVKLFIICVHLASYQI PFGGNKNSGMGAELGKRALENYTEGNHVLPVSLVKETLAPNTETASPARWPIH
References
External Links
ResourceLink
Saccharomyces Genome Database ALD1
Uniprot IDP22281
Uniprot NameALDHX_YEAST
GenBank Gene IDM57887
Genebank Protein ID171048
General Reference
  • Saigal, D., Cunningham, S. J., Farres, J., Weiner, H. (1991). "Molecular cloning of the mitochondrial aldehyde dehydrogenase gene of Saccharomyces cerevisiae by genetic complementation." J Bacteriol 173:3199-3208.2022618