Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCholine/ethanolaminephosphotransferase 1
Synonyms
  • ETHPT
  • Ethanolaminephosphotransferase 1
Gene NameEPT1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, for other substituted phosphate groups
Specific FunctionInvolved in protein-dependent process of phospholipid transport to distribute phosphatidyl ethanolamine to the lumenal surface. The multiple transmembrane domains and lumenal hydrophilic domains of the ethanolaminephosphotransferase might participate in the transport process. EPT1 catalyzes both choline- and ethanolamine-phosphotransferase reactions
Cellular LocationMicrosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Ether lipid metabolismPW002492 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Ether lipid metabolismec00565 Map00565
Glycerophospholipid metabolismec00564 Map00564
SMPDB ReactionsNot Available
KEGG Reactions
CDP-Ethanolamine + DG(16:0/16:0/0:0)PE(14:0/16:1(9Z)) + Cytidine monophosphate + hydron
Metabolites
YMDB IDNameView
YMDB00090CiticolineShow
YMDB00389CDP-EthanolamineShow
YMDB00406Cytidine monophosphateShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
Process
metabolic process
organophosphate metabolic process
phospholipid metabolic process
phospholipid biosynthetic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR123W
Gene Sequence>1176 bp ATGGGATATTTTGTTCCGGATTCACATATCGAAAATCTAAAGTCATATAAATATCAAAGT GAAGACCGCTCGCTGGTATCGAAGTATTTCTTAAAGCCATTTTGGCAAAGATTTTGTCAC ATATTTCCCACGTGGATGGCGCCCAACATCATCACATTATCAGGATTTGCTTTTATAGTT ATCAACGTGTTGACTGTATTCTATTACGATCCAAACCTTAACACAGATACGCCTCGCTGG ACATATTTTTCTTACGCTTTAGGTGTATTCCTATATCAAACGTTCGTAGGAAGTGATGGT GTACACGCTCGCCGTATCAATCAATCAGGACCCTTAGGAGAACTATTCGATCATAGTATT GATGCCATTAATTCTACTCTGTCTATTTTCATCTTCGCATCCGAAACTGGAATGGGATTT TCGTATAACTTAATGTTATCCCAATTTGCGATGCTGACGAATTTTTACTTAAGTACTTGG GAAGAGTACCATACACACACATTATACTTAAGTGAGTTTTCTGGACCCGTGGAAGGCATC CTGATTGTTTGCGTTTCATTGATACTGACAGGTATATACGGAAAACAGGTAATCTGGCAT ACCTACTTATTTACAATTACAGTTGGTGATAAGGTAATTGATGTAGACACTCTAGATATT GTTTTTTCCCTAGCTGTTTTCGGTTTGGTTATGAACGCATTGTCTGCGAAAAGAAACGTG GATAAGTATTATAGAAACAGCACTTCTTCGGCCAACAATATCACGCAAATTGAGCAAGAT AGTGCTATAAAAGGTCTTTTGCCCTTTTTTGCCTATTATGCAAGCATTGCTTTACTAGTG TGGATGCAACCAAGCTTTATTACACTCTCTTTCATCCTTTCCGTTGGTTTCACGGGAGCA TTTACCGTCGGAAGAATAATCGTTTGCCATTTAACTAAGCAGAGCTTTCCCATGTTCAAT GCACCCATGTTAATTCCTTTGTGCCAGATAGTATTGTACAAAATATGTCTATCCCTTTGG GGAATTGAGTCTAATAAAATCGTCTTTGCCCTATCTTGGCTTGGGTTCGGTCTCTCACTA GGTGTTCACATTATGTTTATGAATGACATTATCCATGAATTTACTGAGTACCTGGACGTT TATGCTTTATCCATCAAGCGCTCCAAGCTGACATAA
Protein Properties
Pfam Domain Function
Protein Residues391
Protein Molecular Weight44559.30078
Protein Theoretical pI6.5
Signalling Regions
  • None
Transmembrane Regions
  • 49-69
  • 175-195
  • 216-236
  • 263-283
  • 289-309
  • 319-339
  • 347-367
Protein Sequence>Choline/ethanolaminephosphotransferase 1 MGYFVPDSHIENLKSYKYQSEDRSLVSKYFLKPFWQRFCHIFPTWMAPNIITLSGFAFIV INVLTVFYYDPNLNTDTPRWTYFSYALGVFLYQTFDGCDGVHARRINQSGPLGELFDHSI DAINSTLSIFIFASETGMGFSYNLMLSQFAMLTNFYLSTWEEYHTHTLYLSEFSGPVEGI LIVCVSLILTGIYGKQVIWHTYLFTITVGDKVIDVDTLDIVFSLAVFGLVMNALSAKRNV DKYYRNSTSSANNITQIEQDSAIKGLLPFFAYYASIALLVWMQPSFITLSFILSVGFTGA FTVGRIIVCHLTKQSFPMFNAPMLIPLCQIVLYKICLSLWGIESNKIVFALSWLGFGLSL GVHIMFMNDIIHEFTEYLDVYALSIKRSKLT
References
External Links
ResourceLink
Saccharomyces Genome Database EPT1
Uniprot IDP22140
Uniprot NameEPT1_YEAST
GenBank Gene IDM59311
Genebank Protein ID171465
General Reference
  • Hjelmstad, R. H., Bell, R. M. (1991). "sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases in Saccharomyces cerevisiae. Nucleotide sequence of the EPT1 gene and comparison of the CPT1 and EPT1 gene products." J Biol Chem 266:5094-5103.1848238
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hjelmstad, R. H., Bell, R. M. (1991). "sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases in Saccharomyces cerevisiae. Mixed micellar analysis of the CPT1 and EPT1 gene products." J Biol Chem 266:4357-4365.1847919