You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name5',5'''-P-1,P-4-tetraphosphate phosphorylase 2
Synonyms
  • ATP adenylyltransferase
  • Ap4A phosphorylase II
  • AP,A phosphorylase
  • Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase
  • AP-4-A phosphorylase
Gene NameAPA2
Enzyme Class
Biological Properties
General FunctionInvolved in ATP adenylyltransferase activity
Specific FunctionSustains the catabolism of Np-4-N' nucleotides, rather than their synthesis
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + hydron + ADPP1,P4-Bis(5'-adenosyl) tetraphosphate + phosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00225P1,P4-Bis(5'-adenosyl) tetraphosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00558GTPShow
YMDB00590P(1),P(4)-bis(5'-adenosyl) tetraphosphateShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
nucleotidyltransferase activity
adenylyltransferase activity
ATP adenylyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR530C
Gene Sequence>978 bp ATGATTGAAGAGAATTTGAAACAGAAAATCCACGATAAGTTCGTTGCAGCCAAAAAGAAT GGGCATCTGAAAGTAACGCATGCAGAATCCAAGAAGTTGAAAGATCCTCAAACGACGACA CAATATTGGGTGACATTTGCTCCATCTTTGGCACTTAAGCCAGACGCTAACAAGAATAGC GATTCAAAGGCGGAGGACCCGTTCGCCAATCCCGACGAAGAACTAGTGGTGACTGAAGAT CTAAATGGTGACGGAGAATATAAGCTGCTACTCAACAAATTTCCTGTGGTCCCTGAACAT AGTCTCCTAGTGACAAGCGAGTTTAAAGACCAGAGATCTGCTTTGACGCCAAGTGACTTG ATGACTGCTTATAATGTGCTCTGTTCTCTCCAAGGAGACAAGGACGATGATGTCACTTGT GAAAGGTATCTGGTCTTTTATAATTGTGGACCTCATAGCGGTTCCTCACAAGATCACAAA CACTTGCAGATCATGCAAATGCCTGAAAAATTTATACCTTTTCAGGACGTATTGTGCAAC GGAAAGGATCATTTCTTGCCCACCTTCAACGCAGAGCCATTACAAGATGATAAGGTTTCC TTTGCTCATTTCGTCTTGCCGCTGCCGGAATCGTCTGATCAAGTGGACGAAGATCTTCTT GCTATGTGTTACGTATCTTTGATGCAGAGAGCACTTACATTTTTCCAAGATTGGACCAAT GAGTCTCCGGAGTTGACCAAGTCATACAATGTGCTACTGACCAAGAAATGGATCTGTGTA GTTCCAAGATCGCATGCCAAGAGTGGACCGCCATTGATGTTAAACATTAACTCCACGGGG TACTGTGGTATGATCCTCGTTAAAGACAGAGAAAAACTAGAGAACCTCACTGAAGATCCT CATCTTGTGGACAAGTCGTTACTGCAATGCGGTTTCCCCAACACAGCAGGCCAAAAACCA ACAGAGTATCACTATTAA
Protein Properties
Pfam Domain Function
Protein Residues325
Protein Molecular Weight36840.5
Protein Theoretical pI5.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>5',5'''-P-1,P-4-tetraphosphate phosphorylase 2 MIEENLKQKIHDKFVAAKKNGHLKVTHAESKKLKDPQTTTQYWVTFAPSLALKPDANKNS DSKAEDPFANPDEELVVTEDLNGDGEYKLLLNKFPVVPEHSLLVTSEFKDQRSALTPSDL MTAYNVLCSLQGDKDDDVTCERYLVFYNCGPHSGSSQDHKHLQIMQMPEKFIPFQDVLCN GKDHFLPTFNAEPLQDDKVSFAHFVLPLPESSDQVDEDLLAMCYVSLMQRALTFFQDWTN ESPELTKSYNVLLTKKWICVVPRSHAKSGPPLMLNINSTGYCGMILVKDREKLENLTEDP HLVDKSLLQCGFPNTAGQKPTEYHY
References
External Links
ResourceLink
Saccharomyces Genome Database APA2
Uniprot IDP22108
Uniprot NameAPA2_YEAST
GenBank Gene IDM60265
Genebank Protein ID171066
General Reference
  • Plateau, P., Fromant, M., Schmitter, J. M., Blanquet, S. (1990). "Catabolism of bis(5'-nucleosidyl) tetraphosphates in Saccharomyces cerevisiae." J Bacteriol 172:6892-6899.2174863
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106