You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name5',5'''-P-1,P-4-tetraphosphate phosphorylase 2
Synonyms
  • ATP adenylyltransferase
  • Ap4A phosphorylase II
  • AP,A phosphorylase
  • Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase
  • AP-4-A phosphorylase
Gene NameAPA2
Enzyme Class
Biological Properties
General FunctionInvolved in ATP adenylyltransferase activity
Specific FunctionSustains the catabolism of Np-4-N' nucleotides, rather than their synthesis
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + hydron + ADPP1,P4-Bis(5'-adenosyl) tetraphosphate + phosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00225P1,P4-Bis(5'-adenosyl) tetraphosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00558GTPShow
YMDB00590P(1),P(4)-bis(5'-adenosyl) tetraphosphateShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
catalytic activity
nucleotidyltransferase activity
transferase activity
adenylyltransferase activity
transferase activity, transferring phosphorus-containing groups
ATP adenylyltransferase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR530C
Gene Sequence>978 bp ATGATTGAAGAGAATTTGAAACAGAAAATCCACGATAAGTTCGTTGCAGCCAAAAAGAAT GGGCATCTGAAAGTAACGCATGCAGAATCCAAGAAGTTGAAAGATCCTCAAACGACGACA CAATATTGGGTGACATTTGCTCCATCTTTGGCACTTAAGCCAGACGCTAACAAGAATAGC GATTCAAAGGCGGAGGACCCGTTCGCCAATCCCGACGAAGAACTAGTGGTGACTGAAGAT CTAAATGGTGACGGAGAATATAAGCTGCTACTCAACAAATTTCCTGTGGTCCCTGAACAT AGTCTCCTAGTGACAAGCGAGTTTAAAGACCAGAGATCTGCTTTGACGCCAAGTGACTTG ATGACTGCTTATAATGTGCTCTGTTCTCTCCAAGGAGACAAGGACGATGATGTCACTTGT GAAAGGTATCTGGTCTTTTATAATTGTGGACCTCATAGCGGTTCCTCACAAGATCACAAA CACTTGCAGATCATGCAAATGCCTGAAAAATTTATACCTTTTCAGGACGTATTGTGCAAC GGAAAGGATCATTTCTTGCCCACCTTCAACGCAGAGCCATTACAAGATGATAAGGTTTCC TTTGCTCATTTCGTCTTGCCGCTGCCGGAATCGTCTGATCAAGTGGACGAAGATCTTCTT GCTATGTGTTACGTATCTTTGATGCAGAGAGCACTTACATTTTTCCAAGATTGGACCAAT GAGTCTCCGGAGTTGACCAAGTCATACAATGTGCTACTGACCAAGAAATGGATCTGTGTA GTTCCAAGATCGCATGCCAAGAGTGGACCGCCATTGATGTTAAACATTAACTCCACGGGG TACTGTGGTATGATCCTCGTTAAAGACAGAGAAAAACTAGAGAACCTCACTGAAGATCCT CATCTTGTGGACAAGTCGTTACTGCAATGCGGTTTCCCCAACACAGCAGGCCAAAAACCA ACAGAGTATCACTATTAA
Protein Properties
Pfam Domain Function
Protein Residues325
Protein Molecular Weight36840.5
Protein Theoretical pI5.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>5',5'''-P-1,P-4-tetraphosphate phosphorylase 2 MIEENLKQKIHDKFVAAKKNGHLKVTHAESKKLKDPQTTTQYWVTFAPSLALKPDANKNS DSKAEDPFANPDEELVVTEDLNGDGEYKLLLNKFPVVPEHSLLVTSEFKDQRSALTPSDL MTAYNVLCSLQGDKDDDVTCERYLVFYNCGPHSGSSQDHKHLQIMQMPEKFIPFQDVLCN GKDHFLPTFNAEPLQDDKVSFAHFVLPLPESSDQVDEDLLAMCYVSLMQRALTFFQDWTN ESPELTKSYNVLLTKKWICVVPRSHAKSGPPLMLNINSTGYCGMILVKDREKLENLTEDP HLVDKSLLQCGFPNTAGQKPTEYHY
References
External Links
ResourceLink
Saccharomyces Genome Database APA2
Uniprot IDP22108
Uniprot NameAPA2_YEAST
GenBank Gene IDM60265
Genebank Protein ID171066
General Reference
  • Plateau, P., Fromant, M., Schmitter, J. M., Blanquet, S. (1990). "Catabolism of bis(5'-nucleosidyl) tetraphosphates in Saccharomyces cerevisiae." J Bacteriol 172:6892-6899.2174863
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106