You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMalate synthase 2, glyoxysomal
Synonyms
  • Degradation of allantoin protein 7
Gene NameDAL7
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionThis isozyme is involved in the degradation of allantoin (purine catabolism)
Cellular LocationGlyoxysome
SMPDB Pathways
Glyoxylate cyclePW002419 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glyoxylate and dicarboxylate metabolismec00630 Map00630
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Glyoxylic acid + Acetyl-CoA + waterCoenzyme A + hydron + (S)-Malic acid
KEGG Reactions
Glyoxylic acid + Acetyl-CoA + waterhydron + Coenzyme A + (S)-malate(2-)
Metabolites
YMDB IDNameView
YMDB00033Glyoxylic acidShow
YMDB00045Coenzyme AShow
YMDB00280(S)-Malic acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
malate synthase activity
catalytic activity
transferase activity
Process
carbohydrate metabolic process
cellular carbohydrate metabolic process
glyoxylate cycle
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIR031C
Gene Sequence>1665 bp ATGGTGAAGATAAGCTTGGACAACACTGCTCTATACGCAGACATCGACACGACTCCTCAA TTTGAACCTTCCAAAACTACTGTAGCTGATATTTTAACAAAAGATGCCTTAGAGTTCATT GTTTTGCTGCATAGAACTTTCAATTCAACACGGAAACAGCTTTTAGCCAACAGAAGCAAT TTACAATCAAAGTTAGACTCTGGTGAATACCGATTTGATTTCTTGCCGGAAACCGAACAA ATCAGGAACGATCCTACATGGCAAGGTGCTATCCCAGCCCCTGGTTTGATCAACAGATCC AGCGAGATTACTGGGCCACCATTGAGAAATATGTTAGTCAACGATTTGAATGCTGAAGTA ACGACATATATGACTGATTTCGAGGACTCTTCATCTCCAACTTGGGAGAACATGATTTAC GGACAAGTTAATCTTTATGATGCCATTAGAAATCAAATCGATTTCAAGACACCAAGAAAG GAGTACAGGTTGAAAGGTGACATTTCAAGACTGCCCACTTTAATTGTCAGACCTCGTGGC TGGCACATGGTGGAGAAGCACCTTTACATAGATGATGAACCGATTAGTGCTTCCATCTTC GATTTTGGTTTATATTTTTACCATAACGCTAAAGAGTTAGTTAAAATTGGTAAAGGACCT TATTTTTACTTACCAAAGATGGAGCACCATATGGAGGTAAAACTATGGAATGACATATTC TGTGTTGCACAAGATTTTATTGGAATGCCCCGCGGTACCATTAGGGCCACTGTTCTGATT GAAACTTTGCCAGCGGCCTTCCAAATGGAGGAGATTATCTATCAAATAAGAGAACATTCA AGCGGTTTGAACTGTGGTCGTTGGGACTACATATTTTCGACCATTAAAAAACTGAGAAAC TTGAATGAACACGTTTTGCCAAATAGGGATCTAGTGACTATGACTTCACCTTTTATGGAT GCTTATGTGAAAAGATTGATCAATACATGTCACCGTAGAGGGGTCCATGCGATGGGTGGT ATGGCTGCCCAAATCCCCATAAAAGATGATCCAAAGGCTAATGAAGCTGCAATGAACAAA GTTCGTAATGACAAAATTAGAGAAATGAAGAATGGGCATGATGGGTCATGGGTAGCACAC CCAGCATTGGCACCGATTTGTAATGAAGTTTTCAGTAACATGGGTACAGCAAATCAAATA TATTTTGTCCCGGATGTACATGTTACATCATCTGATTTATTGAATACGAAGATTCAAGAT GCTCAAGTCACTACTGAGGGAATCAGAGTAAACTTGGATATTGGCCTACAATATATGGAG GCTTGGTTAAGGGGATCTGGTTGTGTCCCAATTAATCATTTGATGGAAGATGCCGCTACT GCGGAAGTATCACGTTGTCAATTGTACCAGTGGGTTAAACATGGTGTTGTCTTAAGTGAT ACCGGTGACAAAGTAACTCCAGAATTGACCGCTAAGATATTAAATGAAGAGACTGCAAAA TTGGCTTCAGCAAGTCCGCTGGGTGAAAAGAACAAGTTTGCCTTGGCAGCCAAGTATTTT TTGCCTGAAGTCACTGGTAAAATCTTTAGCGACTTCTTGACCACTTTATTGTATGATGAA ATTATTAAGCCAAGTGCCAAACCAGTTGACTTAAGTAAATTATAG
Protein Properties
Pfam Domain Function
Protein Residues554
Protein Molecular Weight62793.39844
Protein Theoretical pI6.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Malate synthase 2, glyoxysomal MVKISLDNTALYADIDTTPQFEPSKTTVADILTKDALEFIVLLHRTFNSTRKQLLANRSN LQSKLDSGEYRFDFLPETEQIRNDPTWQGAIPAPGLINRSSEITGPPLRNMLVNALNAEV TTYMTDFEDSSSPTWENMIYGQVNLYDAIRNQIDFKTPRKEYRLKDDISRLPTLIVRPRG WHMVEKHLYIDDEPISASIFDFGLYFYHNAKELVKIGKGPYFYLPKMEHHMEVKLWNDIF CVAQDFIGMPRGTIRATVLIETLPAAFQMEEIIYQIREHSSGLNCGRWDYIFSTIKKLRN LPEHVLPNRDLVTMTSPFMDAYVKRLINTCHRRGVHAMGGMAAQIPIKDDPKANEAAMNK VRNDKIREMKNGHDGSWVAHPALAPICNEVFSNMGTANQIYFVPDVHVTSSDLLNTKIQD AQVTTEGIRVNLDIGLQYMEAWLRGSGCVPINHLMEDAATAEVSRCQLYQWVKHGVVLSD TGDKVTPELTAKILNEETAKLASASPLGEKNKFALAAKYFLPEVTGKIFSDFLTTLLYDE IIKPSAKPVDLSKL
References
External Links
ResourceLink
Saccharomyces Genome Database DAL7
Uniprot IDP21826
Uniprot NameMASZ_YEAST
GenBank Gene IDM28124
Genebank Protein ID556463
General Reference
  • Yoo, H. S., Cooper, T. G. (1989). "The DAL7 promoter consists of multiple elements that cooperatively mediate regulation of the gene's expression." Mol Cell Biol 9:3231-3243.2552287
  • Fernandez, E., Fernandez, M., Rodicio, R. (1993). "Two structural genes are encoding malate synthase isoenzymes in Saccharomyces cerevisiae." FEBS Lett 320:271-275.8462696
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870