You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibonucleoside-diphosphate reductase large chain 2
Synonyms
  • Ribonucleotide reductase DNA damage-inducible regulatory subunit 2
  • Ribonucleotide reductase R1 subunit 2
  • Ribonucleotide reductase large subunit 2
Gene NameRNR3
Enzyme Class
Biological Properties
General FunctionInvolved in oxidation-reduction process
Specific FunctionProvides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides
Cellular LocationCytoplasm
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Purine metabolismec00230 Map00230
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00257Guanosine diphosphateShow
YMDB00890waterShow
YMDB00901dADPShow
YMDB00914ADPShow
GO Classification
Component
ribonucleoside-diphosphate reductase complex
macromolecular complex
protein complex
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
oxidoreductase activity
protein binding
oxidoreductase activity, acting on CH or CH2 groups
catalytic activity
oxidoreductase activity, acting on CH or CH2 groups, disulfide as acceptor
ribonucleoside-diphosphate reductase activity
Process
macromolecule metabolic process
DNA metabolic process
DNA replication
cellular macromolecule metabolic process
oxidation reduction
metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>YIL066C RNR3 SGDID:S000001328, Chr IX from 240708-238099, reverse complement, Verified ORF, "Minor isoform of the large subunit of ribonucleotide-diphosphate reductase; the RNR complex catalyzes rate-limiting step in dNTP synthesis, regulated by DNA repli ATGTACGTTATTAAAAGAGACGGCCGCAAAGAGCCCGTTCAATTCGATAAAATTACCTCC CGTATCACCCGTTTGTCATACGGTTTAGACCCAAACCGTATTGATGCTGTTAAGGTAACC CAACGTATTATTTCTGGTGTGTACTCCGGTGTTACTACCGTTGAGCTGGACAATCTTGCA GCTGAAACATGTGCATACATGACCACTGTGCACCCTGATTATGCCACTCTAGCCGCTAGA ATCGCCATCTCTAACTTACATAAGCAAACCACAAAGCAATTCTCCAAAGTTATTGAGGAT TTACACGACTGGATTAACCCAGCTACTGGAAAGCATGCTCCTATGATTTCGGACGAAATT TACAACATTGTCATGGAAAACAAAGATACTTTGAACTCGGCCATCGTGTACGATAGGGAT TTCCAGTATACGTATTTCGGATTCAAGACACTGGAGCGTTCGTACTTGCTAAGACTGAAC GGTGAAGTGGCAGAACGTCCTCAGCATTTGGTAATGCGTGTGGCGCTAGGTATCCATGGT AGCGATATCGAATCTGTGCTGAAGACTTATAATTTGATGTCGTTAAGATACTTCACTCAC GCTTCCCCAACTTTATTCAACGCTGGTACGCCACATCCTCAAATGTCTTCATGTTTCTTA ATTGCCATGAAGGATGACTCTATCGAAGGTATTTATGATACTTTGAAAGAATGTGCTATG ATTTCCAAAACTGCAGGTGGTGTTGGTCTTCATATCAACAACATCCGTTCCACAGGTTCT TATATCGCTGGTACCAACGGTACTTCAAACGGGTTGATTCCTATGATTCGTGTTTTCAAT AATACTGCCCGTTATGTGGACCAGGGTGGTAACAAGAGACCTGGTGCTTTCGCCCTTTTC TTGGAGCCATGGCATGCAGATATCTTCGACTTTGTCGATATCAGAAAAACACATGGTAAG GAAGAAATTCGTGCAAGAGATTTGTTCCCTGCTCTATGGATCCCTGATCTTTTCATGAAA CGTGTTCAAGAGGATGGGCCTTGGACTTTGTTTTCGCCCAGTGCTGCCCCAGGTTTAGAT GATGTGTGGGGTGATGAATTTGAAGAACTATATACTCGTTACGAAAGAGAAGGTCGTGGT AAAACAATTAAAGCCCAAAAGTTGTGGTATGCCATTTTGCAAGCACAGACAGAAACAGGT ACACCTTTCATGGTTTATAAGGACGCATGTAACAGGAAGACAAACCAACAGAACTTAGGT ACTATCAAATCATCTAATTTATGTTGTGAAATCGTCGAATATTCCTCCCCGGATGAAACT GCAGTTTGTAATTTAGCTTCTATTGCCCTACCAGCATTCGTTGAGGTTTCAGAAGATGGT AAAACTGCAAGCTATAATTTCGAGAGATTACACGAGATTGCTAAAGTCATTACTCACAAC TTGAACAGAGTTATCGACCGTAATTACTATCCAGTTCCCGAGGCTAGAAATTCAAATATG AAGCATAGACCTATTGCTCTTGGTGTCCAGGGTTTGGCCGATACTTATATGATGTTGCGT CTACCCTTTGAATCGGAAGAAGCTCAAACTCTAAACAAACAAATCTTCGAAACTATTTAC CATGCTACTCTTGAAGCCTCCTGTGAATTGGCCCAAAAAGAAGGTAAATATTCTACTTTT GAAGGTTCTCCAGCTTCTAAGGGTATTTTACAATTCGATATGTGGAACGCTAAACCATTT GGCATGTGGGATTGGGAAACCTTAAGAAAGGACATTGTTAAACATGGGTTAAGAAACTCT TTGACTATGGCACCAATGCCAACCGCCTCAACTTCCCAAATTCTTGGTTATAATGAATGC TTCGAACCAGTGACCTCAAACATGTACTCTCGTCGTGTCCTGTCTGGTGAATTCCAAGTT GTTAATCCATATTTACTACGTGATTTAGTCGACCTGGGTATTTGGGATGATAGTATGAAA CAATATCTAATTACACAAAATGGTTCTATTCAAGGCTTACCAAATGTGCCACAAGAATTG AAGGAATTATACAAAACCGTCTGGGAAATCTCTCAAAAGACCATTATCAATATGGCTGCT GATCGTGCCATCTACATCGATCAGTCTCATTCCTTGAATCTTTTCTTGCAAGCACCATCA ATGGGTAAGATTACTAGTATGCATTTCTACGGTTGGAAGAAGGGTTTAAAAACTGGTATG TACTACTTAAGAACGCAAGCCGCCTCCGCTGCTATTCAATTTACCATTGATCAAGAGGTT GCCGATCAAGCCGCTACACATATTGCTTCCGTCTCAGAATTGGATCGTCCAGTTTATGTT CCAAAGGGTACAAAATTCTCTGAACAAAAGGCGGCATCTGCGCTTACCGAAAGCTCAGAT AATGAGAAGGATGCATCTCCAGTTCCATCCGAACAATCATCGGTGTCGAGTGCCATGTCA AATGTGAAATTGGAAGATAGTGTTGCCCCAGCAGTTCCAACGGAAACAATAAAAGAAGAT TCCGACGAGAAGAAATGTGACATTTACAATGAAAAGGTGATTGCTTGTACTGCTCCTACT CCAGAAGCTTGTGAGTCATGTTCCGGTTGA
Protein Properties
Pfam Domain Function
Protein Residues869
Protein Molecular Weight97513.79688
Protein Theoretical pI5.86
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribonucleoside-diphosphate reductase large chain 2 MYVIKRDGRKEPVQFDKITSRITRLSYGLDPNRIDAVKVTQRIISGVYSGVTTVELDNLA AETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSKVIEDLHDWINPATGKHAPMISDEI YNIVMENKDTLNSAIVYDRDFQYTYFGFKTLERSYLLRLNGEVAERPQHLVMRVALGIHG SDIESVLKTYNLMSLRYFTHASPTLFNAGTPHPQMSSCFLIAMKDDSIEGIYDTLKECAM ISKTAGGVGLHINNIRSTGSYIAGTNGTSNGLIPMIRVFNNTARYVDQGGNKRPGAFALF LEPWHADIFDFVDIRKTHGKEEIRARDLFPALWIPDLFMKRVQEDGPWTLFSPSAAPGLD DVWGDEFEELYTRYEREGRGKTIKAQKLWYAILQAQTETGTPFMVYKDACNRKTNQQNLG TIKSSNLCCEIVEYSSPDETAVCNLASIALPAFVEVSEDGKTASYNFERLHEIAKVITHN LNRVIDRNYYPVPEARNSNMKHRPIALGVQGLADTYMMLRLPFESEEAQTLNKQIFETIY HATLEASCELAQKEGKYSTFEGSPASKGILQFDMWNAKPFGMWDWETLRKDIVKHGLRNS LTMAPMPTASTSQILGYNECFEPVTSNMYSRRVLSGEFQVVNPYLLRDLVDLGIWDDSMK QYLITQNGSIQGLPNVPQELKELYKTVWEISQKTIINMAADRAIYIDQSHSLNLFLQAPS MGKITSMHFYGWKKGLKTGMYYLRTQAASAAIQFTIDQEVADQAATHIASVSELDRPVYV PKGTKFSEQKAASALTESSDNEKDASPVPSEQSSVSSAMSNVKLEDSVAPAVPTETIKED SDEKKCDIYNEKVIACTAPTPEACESCSG
References
External Links
ResourceLink
Saccharomyces Genome Database RNR3
Uniprot IDP21672
Uniprot NameRIR3_YEAST
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Yagle, K., McEntee, K. (1990). "The DNA damage-inducible gene DIN1 of Saccharomyces cerevisiae encodes a regulatory subunit of ribonucleotide reductase and is identical to RNR3." Mol Cell Biol 10:5553-5557.2204819
  • Elledge, S. J., Davis, R. W. (1990). "Two genes differentially regulated in the cell cycle and by DNA-damaging agents encode alternative regulatory subunits of ribonucleotide reductase." Genes Dev 4:740-751.2199320
  • Domkin, V., Thelander, L., Chabes, A. (2002). "Yeast DNA damage-inducible Rnr3 has a very low catalytic activity strongly stimulated after the formation of a cross-talking Rnr1/Rnr3 complex." J Biol Chem 277:18574-18578.11893751
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Yao, R., Zhang, Z., An, X., Bucci, B., Perlstein, D. L., Stubbe, J., Huang, M. (2003). "Subcellular localization of yeast ribonucleotide reductase regulated by the DNA replication and damage checkpoint pathways." Proc Natl Acad Sci U S A 100:6628-6633.12732713
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956