Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSpore wall maturation protein DIT1
SynonymsNot Available
Gene NameDIT1
Enzyme ClassNot Available
Biological Properties
General FunctionSecondary metabolites biosynthesis, transport and catabolism
Specific FunctionInvolved in spore wall maturation. Catalyzes a two step reaction that leads to the LL-dityrosine containing precursor of the spore wall
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Tyrosine + N10-Formyl-THFN-Formyl-L-tyrosine + 5,6,7,8-Tetrahydrofolic acid + hydron
Metabolites
YMDB IDNameView
YMDB00364L-TyrosineShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB0051710-Formyltetrahydrofolic acidShow
YMDB00726N-Formyl-L-tyrosineShow
YMDB00862hydronShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR403W
Gene Sequence>1611 bp ATGACATTTACTAGCAACTTGCCCTCAAGCTCCGAGCAGTCAATATCACCACCTGCCTCT TCATTTTCTTCATCGACTGATACGTTGAAAGATATTGATATTCCCCATAATGGGGCCGAT TTGTCTACATATAGTAAATTTCTGGCCCTGTATTGCAGAAGCGACAAATGTGACGATTTT TACTCTTTAGAGGAAAAACAGAATTGTAAATTTGGAGACCAATGGCTCGACTTTATCAAC ACTATTCACAATCTGGACTTTTCTGAATCCGAAGTAAGTGGACGGGTTTCTGAAAGAATT TTGCCAGCTTCTTTAGCAAATAAATTTACCAATAATTTAGGAGTGGCAATAAAGATTTCT GAATATACACGCGATGACGAACGCCAGATTCGTGGGTGTGTTACAACAGTTGAGAATGAA AATTCTTTCAATAACTGGTTCGTATATCATATTTTAGACCAATCTCAATTATCTCTAAGT GAACATCCAATTGTAACCAAAGAAGTTAAGTATCACGAATTATTTGCAGATTTTTTTGAG AAAAATTTGAAAAACACAATAGTTAATGATCAATGGAATTTTGGTGGCCGTGATTATTTT ATTGAACGTTCAAGATATTTTACCGATCGATATTTGAGAATTGAATGCATCTTGCCAGCG TTTCCATGTAAGTCATCTAATGAGCAAAAAGTGTACGGTTCCGTTCCTGACAAAGGCGAA GAACTCGCTTTGAAAAGATTAATAAAAGCCACACAAGACCTTGTCAAGATATATCCACCG GGTATGAAAATTTGGATAGTTAGTGATGGCCATGTTTTCTCCGATTGTATTGGGGTCGAT GATGACGTCGTGAGTACTTACACGACCAAATTGCACGAACTGTATAAAAGAGTGGCTATA CCTGGTGTTGACGCCATTGGCTTTTGTGGATTGAACGATTTATTTTTTAGCGGTGCAGCT AGTAAAGTTTTCGATCCAAAGTGGGTTAGTGATGTTGAAGTTGCACACTACACAGGAACT CAAATCTGTCCTAAGTCCGATTTGTCGAGACAGATTTTGATGAAAGGCTGTGATACAGAT GCAGGTCGTTTGAGAAAGCAGATTGCAATAGAAGGACATCCAAGATTGCATCTGTATAGG GGCTTTTCACGTTTTATGATGGAAGATTTATCTCTACTGGAACATTTCCAAAGTTATTCC AGAAAAAAATTCAAGAAAATCATTTCAATGATCGCTTTTAACATGATTAAGAGAAATGAC GCGTATTCGAACTTAGTGGAATTGATATTCCCTCATCATTTGAGAATTTCTATTCATGCG CACACTAACAGCGGGCCCAAATTTGGTATAAAAGTAATCTCCAACGAACAGTGTTCTATT GTTAGTTCGTTAGAAGACCTTGATGAACCCAAATTTGAAGATTTTTTACATATTCCCACA CCTTGGCATAATTGTGTCGTGAAGGTTGAGGATGAAAAGGAGAAATACTTTTTGACAAAA TCAAAAGTAGTCAAGGAGGCTCTCGAAAAGGGTATGTATGATGGTGTATGGAAAGATACT CGTTTCGATATTGGAGAAGGAGGACATTTCGTTATCAAGAAAATCTCTTAA
Protein Properties
Pfam Domain Function
Protein Residues536
Protein Molecular Weight61390.10156
Protein Theoretical pI6.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Spore wall maturation protein DIT1 MTFTSNLPSSSEQSISPPASSFSSSTDTLKDIDIPHNGADLSTYSKFLALYCRSDKCDDF YSLEEKQNCKFGDQWLDFINTIHNLDFSESEVSGRVSERILPASLANKFTNNLGVAIKIS EYTRDDERQIRGCVTTVENENSFNNWFVYHILDQSQLSLSEHPIVTKEVKYHELFADFFE KNLKNTIVNDQWNFGGRDYFIERSRYFTDRYLRIECILPAFPCKSSNEQKVYGSVPDKGE ELALKRLIKATQDLVKIYPPGMKIWIVSDGHVFSDCIGVDDDVVSTYTTKLHELYKRVAI PGVDAIGFCGLNDLFFSGAASKVFDPKWVSDVEVAHYTGTQICPKSDLSRQILMKGCDTD AGRLRKQIAIEGHPRLHLYRGFSRFMMEDLSLLEHFQSYSRKKFKKIISMIAFNMIKRND AYSNLVELIFPHHLRISIHAHTNSGPKFGIKVISNEQCSIVSSLEDLDEPKFEDFLHIPT PWHNCVVKVEDEKEKYFLTKSKVVKEALEKGMYDGVWKDTRFDIGEGGHFVIKKIS
References
External Links
ResourceLink
Saccharomyces Genome Database DIT1
Uniprot IDP21623
Uniprot NameDIT1_YEAST
GenBank Gene IDU32274
Genebank Protein ID927334
General Reference
  • Briza, P., Breitenbach, M., Ellinger, A., Segall, J. (1990). "Isolation of two developmentally regulated genes involved in spore wall maturation in Saccharomyces cerevisiae." Genes Dev 4:1775-1789.2249774
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Briza, P., Eckerstorfer, M., Breitenbach, M. (1994). "The sporulation-specific enzymes encoded by the DIT1 and DIT2 genes catalyze a two-step reaction leading to a soluble LL-dityrosine-containing precursor of the yeast spore wall." Proc Natl Acad Sci U S A 91:4524-4528.8183942