You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibonucleoside-diphosphate reductase large chain 1
Synonyms
  • Ribonucleotide reductase R1 subunit 1
  • Ribonucleotide reductase large subunit 1
Gene NameRNR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidation-reduction process
Specific FunctionProvides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides
Cellular LocationCytoplasm
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Purine metabolismec00230 Map00230
Pyrimidine metabolismec00240 Map00240
SMPDB Reactions
CDP + reduced thioredoxin → water + oxidized thioredoxin + dCDP
Uridine 5'-diphosphate + a reduced NrdH glutaredoxin-like protein → water + an oxidized NrdH glutaredoxin-like protein + dUDP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00064CDPShow
YMDB00257Guanosine diphosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00746dUDPShow
YMDB00890waterShow
YMDB00898dGDPShow
YMDB00901dADPShow
YMDB00914ADPShow
YMDB00916dCDPShow
GO Classification
Component
macromolecular complex
protein complex
ribonucleoside-diphosphate reductase complex
Function
protein binding
binding
nucleoside binding
oxidoreductase activity, acting on CH or CH2 groups
purine nucleoside binding
oxidoreductase activity, acting on CH or CH2 groups, disulfide as acceptor
adenyl nucleotide binding
ribonucleoside-diphosphate reductase activity
adenyl ribonucleotide binding
ATP binding
oxidoreductase activity
catalytic activity
Process
metabolic process
macromolecule metabolic process
DNA metabolic process
DNA replication
cellular macromolecule metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 5
LocusYER070W
Gene Sequence>2667 bp ATGTACGTTTATAAAAGAGACGGTCGTAAAGAACCTGTCCAATTCGATAAGATTACCGCT CGTATATCACGCTTATGCTATGGTTTAGATCCAAAACATATCGACGCCGTTAAGGTCACC CAACGTATCATTTCTGGTGTCTATGAAGGTGTCACAACAATCGAACTAGACAACTTAGCC GCTGAAACATGCGCTTATATGACTACTGTTCATCCAGATTACGCCACCCTAGCGGCCAGA ATTGCCATTTCTAATTTACATAAACAAACCACAAAACAATTTTCTAAGGTTGTCGAAGAT CTTTATAGATACGTCAATGCTGCTACTGGTAAGCCCGCTCCCATGATCTCTGATGATGTC TACAATATTGTCATGGAAAACAAGGATAAATTGAACTCCGCAATTGTCTATGACAGAGAT TTTCAGTACAGTTATTTTGGTTTTAAAACTTTGGAACGTTCTTATTTACTAAGAATCAAC GGTCAAGTGGCCGAACGTCCACAACATTTAATTATGAGAGTCGCACTAGGCATCCACGGT AGAGATATCGAGGCTGCTTTAGAAACGTATAACTTGATGTCTCTAAAATATTTTACTCAC GCCTCTCCAACGTTGTTCAATGCCGGTACTCCAAAACCTCAAATGTCCTCTTGTTTCTTG GTTGCCATGAAGGAGGACTCTATCGAGGGGATTTACGACACCTTGAAGGAATGTGCTTTG ATTTCCAAAACTGCTGGTGGTATTGGTCTACATATCCATAACATTCGTTCAACTGGTTCT TACATTGCTGGTACAAACGGTACTTCTAACGGTTTAATTCCTATGATTCGTGTTTTCAAT AACACTGCCCGTTATGTTGACCAGGGTGGTAATAAAAGACCTGGTGCGTTTGCCCTTTAC CTGGAACCATGGCATGCTGATATATTTGATTTTATTGATATTAGGAAGAACCACGGTAAA GAGGAAATTCGTGCAAGAGATTTGTTCCCTGCTCTATGGATTCCTGATCTTTTCATGAAG CGTGTCGAAGAAAATGGGACCTGGACATTATTCTCTCCAACATCAGCTCCTGGTTTAAGC GATTGTTACGGTGACGAGTTTGAGGCTCTATATACCCGCTACGAGAAAGAAGGTCGTGGT AAGACTATCAAAGCCCAAAAATTATGGTATTCCATTTTGGAAGCTCAAACTGAAACTGGT ACACCTTTCGTTGTTTACAAGGATGCTTGTAACAGAAAATCTAATCAAAAAAACTTAGGT GTCATCAAGTCATCAAACTTATGCTGTGAAATTGTTGAATACTCAGCTCCAGATGAAACT GCTGTTTGTAACTTGGCTTCCGTTGCCTTACCAGCATTCATTGAAACTTCTGAGGATGGT AAGACTTCCACATACAACTTCAAAAAATTACATGAAATTGCTAAAGTTGTTACTCGTAAT TTAAACAGAGTCATTGATCGTAATTACTACCCTGTTGAAGAAGCGAGAAAATCCAATATG AGACATAGACCAATTGCTTTGGGTGTTCAAGGTCTCGCTGACACTTTCATGCTGTTACGT TTGCCATTTGATTCTGAGGAAGCCCGTTTGCTAAATATCCAAATCTTTGAAACTATTTAT CATGCCTCCATGGAAGCTTCTTGTGAACTAGCTCAGAAGGACGGTCCATACGAAACTTTC CAAGGATCTCCTGCTTCTCAAGGTATACTACAGTTTGATATGTGGGACCAAAAACCCTAC GGCATGTGGGATTGGGACACCTTAAGAAAAGATATCATGAAGCATGGTGTTAGAAATTCC TTGACCATGGCACCAATGCCTACTGCATCCACATCCCAAATATTGGGTTATAATGAATGT TTCGAACCAGTCACTTCCAATATGTACTCCCGTCGTGTCTTATCCGGTGAATTCCAGGTT GTGAACCCTTACTTACTGCGTGACTTGGTTGATTTAGGTATTTGGGATGAGGGTATGAAA CAGTATCTGATTACACAAAATGGCTCCATTCAAGGCTTACCAAACGTTCCACAAGAATTG AAGGACTTATACAAGACTGTTTGGGAAATTTCACAAAAGACTATCATTAACATGGCAGCC GATCGTTCTGTCTATATTGATCAATCTCATTCTTTGAATTTGTTCTTACGTGCCCCAACT ATGGGTAAACTAACAAGTATGCATTTTTACGGATGGAAGAAGGGATTGAAGACCGGTATG TACTATTTGAGAACCCAAGCTGCATCTGCTGCAATTCAATTTACTATTGATCAGAAGATT GCGGATCAAGCTACAGAAAACGTTGCTGATATTTCCAACTTGAAGCGTCCATCATATATG CCTTCCAGTGCAAGCTACGCTGCCAGCGATTTCGTGCCCGCAGCTGTGACTGCAAACGCA ACTATTCCATCTCTAGATAGCTCCTCGGAAGCTTCAAGAGAGGCATCTCCAGCTCCAACA GGTAGCCACTCATTAACTAAAGGAATGGCAGAATTAAACGTTCAAGAGTCTAAGGTAGAA GTTCCTGAAGTACCTGCCCCAACTAAGAATGAAGAAAAAGCTGCCCCCATCGTTGATGAT GAGGAAACCGAGTTCGACATTTACAACTCTAAGGTTATAGCATGTGCTATTGATAACCCA GAAGCTTGTGAAATGTGTTCGGGTTAA
Protein Properties
Pfam Domain Function
Protein Residues888
Protein Molecular Weight99560.20313
Protein Theoretical pI6.1
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribonucleoside-diphosphate reductase large chain 1 MYVYKRDGRKEPVQFDKITARISRLCYGLDPKHIDAVKVTQRIISGVYEGVTTIELDNLA AETCAYMTTVHPDYATLAARIAISNLHKQTTKQFSKVVEDLYRYVNAATGKPAPMISDDV YNIVMENKDKLNSAIVYDRDFQYSYFGFKTLERSYLLRINGQVAERPQHLIMRVALGIHG RDIEAALETYNLMSLKYFTHASPTLFNAGTPKPQMSSCFLVAMKEDSIEGIYDTLKECAL ISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMIRVFNNTARYVDQGGNKRPGAFALY LEPWHADIFDFIDIRKNHGKEEIRARDLFPALWIPDLFMKRVEENGTWTLFSPTSAPGLS DCYGDEFEALYTRYEKEGRGKTIKAQKLWYSILEAQTETGTPFVVYKDACNRKSNQKNLG VIKSSNLCCEIVEYSAPDETAVCNLASVALPAFIETSEDGKTSTYNFKKLHEIAKVVTRN LNRVIDRNYYPVEEARKSNMRHRPIALGVQGLADTFMLLRLPFDSEEARLLNIQIFETIY HASMEASCELAQKDGPYETFQGSPASQGILQFDMWDQKPYGMWDWDTLRKDIMKHGVRNS LTMAPMPTASTSQILGYNECFEPVTSNMYSRRVLSGEFQVVNPYLLRDLVDLGIWDEGMK QYLITQNGSIQGLPNVPQELKDLYKTVWEISQKTIINMAADRSVYIDQSHSLNLFLRAPT MGKLTSMHFYGWKKGLKTGMYYLRTQAASAAIQFTIDQKIADQATENVADISNLKRPSYM PSSASYAASDFVPAAVTANATIPSLDSSSEASREASPAPTGSHSLTKGMAELNVQESKVE VPEVPAPTKNEEKAAPIVDDEETEFDIYNSKVIACAIDNPEACEMCSG
References
External Links
ResourceLink
Saccharomyces Genome Database RNR1
Uniprot IDP21524
Uniprot NameRIR1_YEAST
GenBank Gene IDU18813
Genebank Protein ID603306
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Elledge, S. J., Davis, R. W. (1990). "Two genes differentially regulated in the cell cycle and by DNA-damaging agents encode alternative regulatory subunits of ribonucleotide reductase." Genes Dev 4:740-751.2199320
  • Ozier-Kalogeropoulos, O., Adeline, M. T., Yang, W. L., Carman, G. M., Lacroute, F. (1994). "Use of synthetic lethal mutants to clone and characterize a novel CTP synthetase gene in Saccharomyces cerevisiae." Mol Gen Genet 242:431-439.8121398
  • Chabes, A., Domkin, V., Thelander, L. (1999). "Yeast Sml1, a protein inhibitor of ribonucleotide reductase." J Biol Chem 274:36679-36683.10593972
  • Chabes, A., Domkin, V., Larsson, G., Liu, A., Graslund, A., Wijmenga, S., Thelander, L. (2000). "Yeast ribonucleotide reductase has a heterodimeric iron-radical-containing subunit." Proc Natl Acad Sci U S A 97:2474-2479.10716984
  • Domkin, V., Thelander, L., Chabes, A. (2002). "Yeast DNA damage-inducible Rnr3 has a very low catalytic activity strongly stimulated after the formation of a cross-talking Rnr1/Rnr3 complex." J Biol Chem 277:18574-18578.11893751
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Yao, R., Zhang, Z., An, X., Bucci, B., Perlstein, D. L., Stubbe, J., Huang, M. (2003). "Subcellular localization of yeast ribonucleotide reductase regulated by the DNA replication and damage checkpoint pathways." Proc Natl Acad Sci U S A 100:6628-6633.12732713
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Xu, H., Faber, C., Uchiki, T., Fairman, J. W., Racca, J., Dealwis, C. (2006). "Structures of eukaryotic ribonucleotide reductase I provide insights into dNTP regulation." Proc Natl Acad Sci U S A 103:4022-4027.16537479
  • Xu, H., Faber, C., Uchiki, T., Racca, J., Dealwis, C. (2006). "Structures of eukaryotic ribonucleotide reductase I define gemcitabine diphosphate binding and subunit assembly." Proc Natl Acad Sci U S A 103:4028-4033.16537480
  • Xu, H., Fairman, J. W., Wijerathna, S. R., Kreischer, N. R., LaMacchia, J., Helmbrecht, E., Cooperman, B. S., Dealwis, C. (2008). "The structural basis for peptidomimetic inhibition of eukaryotic ribonucleotide reductase: a conformationally flexible pharmacophore." J Med Chem 51:4653-4659.18610997