You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameOsmotic growth protein 1
SynonymsNot Available
Gene NameOSM1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in electron carrier activity
Specific FunctionCould be a fumarate reductase
Cellular LocationCytoplasm (Probable)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB Reactions
L-Aspartic acid + water + oxygenOxalacetic acid + Ammonia + Hydrogen peroxide
KEGG Reactions
Fumaric acid + FADH2FAD + Succinic acid
Fumaric acid + FMNH2Flavin Mononucleotide + Succinic acid
Metabolites
YMDB IDNameView
YMDB00085Flavin MononucleotideShow
YMDB00091AmmoniaShow
YMDB00101Fumaric acidShow
YMDB00235Oxalacetic acidShow
YMDB00296FADShow
YMDB00338Succinic acidShow
YMDB00597FADH2Show
YMDB00686FMNH2Show
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00896L-Aspartic acidShow
YMDB00900oxygenShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
electron carrier activity
oxidoreductase activity, acting on the CH-CH group of donors
succinate dehydrogenase activity
catalytic activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 10
LocusYJR051W
Gene Sequence>1506 bp ATGATTAGATCTGTGAGAAGGGTTTTCATTTACGTCTCAATATTCGTATTGATAATAGTT TTGAAAAGAACATTAAGTGGCACAGATCAAACGTCAATGAAACAACCAGTGGTGGTCATT GGCTCTGGTTTGGCAGGCTTAACCACAAGTAATCGTCTCATTAGTAAATACAGAATTCCT GTTGTGCTTTTGGATAAGGCGGCTTCTATTGGTGGGAATTCTATAAAGGCTTCTAGTGGT ATTAATGGTGCTCACACAGACACTCAACAAAATTTAAAGGTAATGGACACTCCCGAATTG TTTTTGAAAGATACTTTGCATTCGGCTAAAGGCAGAGGGGTTCCATCACTGATGGATAAG TTGACTAAGGAATCCAAGAGTGCTATCAGGTGGTTGCAAACAGAATTCGATTTGAAATTA GACCTCCTTGCGCAATTGGGCGGTCACTCTGTTCCAAGGACCCATAGATCTTCTGGCAAA TTACCACCAGGTTTTGAAATCGTGCAAGCGTTATCAAAAAAACTAAAGGATATCTCTTCC AAAGATTCCAATCTCGTGCAGATTATGCTAAACAGTGAAGTAGTGGATATCGAGCTTGAT AATCAAGGTCATGTTACTGGTGTAGTATATATGGACGAGAACGGAAACCGTAAAATCATG AAGTCACACCATGTCGTGTTTTGCTCAGGTGGATTTGGTTACTCTAAGGAAATGTTGAAA GAGTACTCACCAAATTTGATTCACTTGCCAACTACTAATGGCAAACAGACTACAGGTGAT GGTCAAAAAATCCTTTCAAAGTTGGGTGCCGAATTGATTGATATGGATCAAGTGCAGGTA CACCCTACCGGCTTCATTGATCCAAATGACCGTGAAAATAACTGGAAGTTTTTGGCTGCA GAGGCATTGAGGGGTTTAGGCGGCATCTTATTGCATCCCACCACTGGAAGAAGGTTTACA AATGAATTGAGCACCAGAGATACAGTAACCATGGAAATACAGTCTAAATGTCCGAAAAAT GATAATAGAGCACTTTTGGTAATGAGCGACAAAGTCTACGAGAACTATACGAATAACATA AACTTTTATATGTCCAAAAACTTAATCAAAAAAGTGTCAATCAACGATCTGATCCGACAA TATGACCTACAAACTACAGCTTCTGAACTGGTAACTGAACTGAAGAGCTATTCCGATGTT AATACTAAGGATACGTTTGATAGGCCATTGATTATCAATGCCTTTGATAAAGATATTTCG ACTGAATCAACTGTTTATGTTGGGGAAGTTACACCAGTTGTTCATTTCACAATGGGTGGT GTGAAAATTAATGAGAAATCTCAGGTAATTAAGAAAAATTCGGAAAGCGTTCTATCTAAT GGGATATTTGCTGCTGGTGAAGTTTCGGGTGGTGTTCATGGAGCCAACAGATTGGGTGGA TCTAGTTTGTTAGAGTGTGTTGTCTTTGGAAAGACAGCTGCGGATAACATAGCAAAATTG TACTGA
Protein Properties
Pfam Domain Function
Protein Residues501
Protein Molecular Weight55064.80078
Protein Theoretical pI9.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Osmotic growth protein 1 MIRSVRRVFIYVSIFVLIIVLKRTLSGTDQTSMKQPVVVIGSGLAGLTTSNRLISKYRIP VVLLDKAASIGGNSIKASSGINGAHTDTQQNLKVMDTPELFLKDTLHSAKGRGVPSLMDK LTKESKSAIRWLQTEFDLKLDLLAQLGGHSVPRTHRSSGKLPPGFEIVQALSKKLKDISS KDSNLVQIMLNSEVVDIELDNQGHVTGVVYMDENGNRKIMKSHHVVFCSGGFGYSKEMLK EYSPNLIHLPTTNGKQTTGDGQKILSKLGAELIDMDQVQVHPTGFIDPNDRENNWKFLAA EALRGLGGILLHPTTGRRFTNELSTRDTVTMEIQSKCPKNDNRALLVMSDKVYENYTNNI NFYMSKNLIKKVSINDLIRQYDLQTTASELVTELKSYSDVNTKDTFDRPLIINAFDKDIS TESTVYVGEVTPVVHFTMGGVKINEKSQVIKKNSESVLSNGIFAAGEVSGGVHGANRLGG SSLLECVVFGKTAADNIAKLY
References
External Links
ResourceLink
Saccharomyces Genome Database OSM1
Uniprot IDP21375
Uniprot NameOSM1_YEAST
GenBank Gene IDL26347
Genebank Protein ID695798
General Reference
  • Melnick, L., Sherman, F. (1990). "Nucleotide sequence of the COR region: a cluster of six genes in the yeast Saccharomyces cerevisiae." Gene 87:157-166.2158927
  • Huang, M. E., Manus, V., Chuat, J. C., Galibert, F. (1994). "Revised nucleotide sequence of the COR region of yeast Saccharomyces cerevisiae chromosome X." Yeast 10:811-818.7975898
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Pealing, S. L., Black, A. C., Manson, F. D., Ward, F. B., Chapman, S. K., Reid, G. A. (1992). "Sequence of the gene encoding flavocytochrome c from Shewanella putrefaciens: a tetraheme flavoenzyme that is a soluble fumarate reductase related to the membrane-bound enzymes from other bacteria." Biochemistry 31:12132-12140.1333793
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956