You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA nucleotidyltransferase, mitochondrial
Synonyms
  • CCA-adding enzyme
  • tRNA CCA-pyrophosphorylase
  • tRNA adenylyltransferase
Gene NameCCA1
Enzyme Class
Biological Properties
General FunctionInvolved in RNA binding
Specific FunctionThis enzyme carries out synthesis of the tRNA CCA terminus without the direction of a template using the multiple accepting and donating subsites within its active site
Cellular LocationMitochondrion. Cytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00279Cytidine triphosphateShow
GO Classification
Component
Not Available
Function
binding
nucleotidyltransferase activity
nucleic acid binding
RNA binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
cellular macromolecule metabolic process
RNA metabolic process
RNA processing
metabolic process
macromolecule metabolic process
Gene Properties
Chromosome Locationchromosome 5
LocusYER168C
Gene Sequence>1641 bp ATGCTACGGTCTACTATATCTCTACTGATGAATAGTGCTGCTCAGAAAACGATGACGAAT TCTAATTTTGTTCTAAATGCACCCAAAATCACCTTAACCAAAGTGGAACAGAACATCTGT AACTTGCTGAACGATTATACAGACTTGTACAATCAAAAGTACCACAATAAGCCTGAGCCA TTGACTCTTCGGATCACGGGCGGATGGGTGCGTGACAAGCTTCTGGGACAAGGTTCTCAC GACTTGGATATTGCCATCAATGTGATGTCAGGTGAGCAATTTGCTACTGGTTTGAACGAG TATTTGCAACAACATTACGCCAAATATGGAGCCAAGCCTCATAATATCCACAAGATTGAC AAGAATCCCGAGAAATCCAAGCATCTGGAAACTGCCACTACTAAGCTCTTTGGCGTTGAA GTGGATTTTGTCAATTTAAGATCTGAAAAGTATACTGAACTTTCCAGGATACCTAAAGTG TGCTTTGGCACACCCGAGGAAGACGCTTTAAGAAGGGATGCTACATTGAACGCTCTTTTC TATAACATTCATAAAGGTGAAGTGGAAGATTTCACCAAGAGAGGTCTGCAAGATCTAAAA GATGGCGTTCTCCGTACTCCGCTTCCTGCAAAACAAACATTTTTGGATGATCCCTTGAGG GTTTTGAGGTTGATCCGTTTTGCTTCTAGATTCAACTTTACCATAGATCCGGAAGTGATG GCTGAAATGGGCGATCCTCAGATTAATGTTGCATTCAATTCAAAAATTTCTAGAGAGCGA GTTGGTGTGGAGATGGAGAAAATATTAGTAGGACCAACCCCTTTATTGGCTTTGCAGCTG ATTCAAAGGGCTCATCTTGAAAATGTTATCTTTTTTTGGCATAATGATAGCTCCGTCGTA AAATTCAACGAAGAGAATTGTCAAGATATGGACAAAATTAATCATGTATACAATGATAAC ATACTAAACTCACACTTGAAAAGTTTTATTGAATTATATCCAATGTTTTTAGAGAAGCTT CCTATCTTAAGGGAAAAAATTGGTCGTTCGCCAGGATTTCAGCAAAATTTTATATTGAGT GCGATCCTGTCCCCCATGGCTAATTTACAAATAATCGGGAACCCAAAGAAGAAAATTAAC AACCTGGTTTCGGTGACAGAAAGCATTGTGAAGGAAGGATTGAAGCTGAGTAAAAATGAT GCAGCAGTTATTGCCAAGACCGTAGATTCAATATGTTCATATGAGGAAATACTTGCTAAG TTTGCAGATCGTTCCCAGCTAAAAAAATCCGAAATCGGTATATTTCTACGGAACTTTAAC GGCGAATGGGAAACAGCACATTTTGCATCTCTATCAGATGCATTTTTAAAGATTCCCAAG CTTGAAACTAAAAAAATTGAATTACTTTTCCAAAATTACAATGAATTTTATTCTTACATA TTTGACAATAATTTGAATAATTGTCATGAACTAAAACCAATAGTGGACGGAAAACAAATG GCAAAACTACTTCAAATGAAGCCAGGTCCATGGCTGGGTAAAATTAATAACGAAGCGATT AGGTGGCAGTTTGATAATCCTACAGGGACTGATCAAGAATTAATAACTCATTTAAAAGCC ATACTACCAAAATACCTGTAG
Protein Properties
Pfam Domain Function
Protein Residues546
Protein Molecular Weight62484.39844
Protein Theoretical pI8.42
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA nucleotidyltransferase, mitochondrial MLRSTISLLMNSAAQKTMTNSNFVLNAPKITLTKVEQNICNLLNDYTDLYNQKYHNKPEP LTLRITGGWVRDKLLGQGSHDLDIAINVMSGEQFATGLNEYLQQHYAKYGAKPHNIHKID KNPEKSKHLETATTKLFGVEVDFVNLRSEKYTELSRIPKVCFGTPEEDALRRDATLNALF YNIHKGEVEDFTKRGLQDLKDGVLRTPLPAKQTFLDDPLRVLRLIRFASRFNFTIDPEVM AEMGDPQINVAFNSKISRERVGVEMEKILVGPTPLLALQLIQRAHLENVIFFWHNDSSVV KFNEENCQDMDKINHVYNDNILNSHLKSFIELYPMFLEKLPILREKIGRSPGFQQNFILS AILSPMANLQIIGNPKKKINNLVSVTESIVKEGLKLSKNDAAVIAKTVDSICSYEEILAK FADRSQLKKSEIGIFLRNFNGEWETAHFASLSDAFLKIPKLETKKIELLFQNYNEFYSYI FDNNLNNCHELKPIVDGKQMAKLLQMKPGPWLGKINNEAIRWQFDNPTGTDQELITHLKA ILPKYL
References
External Links
ResourceLink
Saccharomyces Genome Database CCA1
Uniprot IDP21269
Uniprot NameCCA1_YEAST
GenBank Gene IDM59870
Genebank Protein ID172994
General Reference
  • Aebi, M., Kirchner, G., Chen, J. Y., Vijayraghavan, U., Jacobson, A., Martin, N. C., Abelson, J. (1990). "Isolation of a temperature-sensitive mutant with an altered tRNA nucleotidyltransferase and cloning of the gene encoding tRNA nucleotidyltransferase in the yeast Saccharomyces cerevisiae." J Biol Chem 265:16216-16220.2204621
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Wolfe, C. L., Lou, Y. C., Hopper, A. K., Martin, N. C. (1994). "Interplay of heterogeneous transcriptional start sites and translational selection of AUGs dictate the production of mitochondrial and cytosolic/nuclear tRNA nucleotidyltransferase from the same gene in yeast." J Biol Chem 269:13361-13366.8175766
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956