You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoribosylaminoimidazole carboxylase
Synonyms
  • AIR carboxylase
  • AIRC
Gene NameADE2
Enzyme Class
Biological Properties
General FunctionInvolved in phosphoribosylaminoimidazole carboxylase activity
Specific Function5-amino-1-(5-phospho-D-ribosyl)imidazole-4- carboxylate = 5-amino-1-(5-phospho-D-ribosyl)imidazole + CO(2)
Cellular LocationNot Available
SMPDB Pathways
One Carbon Pool by Folate IPW002468 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB Reactions
Tetrahydrofolic acid + 5'-Phosphoribosyl-N-formylglycinamideN10-Formyl-THF + Glycineamideribotide
5'-phosphoribosyl-a-N-formylglycineamidine + Tetrahydrofolic acidwater + Glycineamideribotide + 5,10-Methenyltetrahydrofolic acid
N1-(5-phospho-β-D-ribosyl)glycinamide + Adenosine triphosphate + Formic acid5'-Phosphoribosyl-N-formylglycinamide + ADP + phosphate + hydron
KEGG Reactions
5-Aminoimidazole ribonucleotide + Carbon dioxide5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate + hydron
Metabolites
YMDB IDNameView
YMDB000015'-Phosphoribosyl-N-formylglycinamideShow
YMDB000655-Aminoimidazole ribonucleotideShow
YMDB000775-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylateShow
YMDB00080N10-Formyl-THFShow
YMDB00109Adenosine triphosphateShow
YMDB00139Tetrahydrofolic acidShow
YMDB001765,10-Methenyltetrahydrofolic acidShow
YMDB00374GlycineamideribotideShow
YMDB00385Formic acidShow
YMDB004925-Amino-1-(5-phospho-D-ribosyl)imidazoleShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00912Carbon dioxideShow
YMDB00914ADPShow
YMDB161505'-phosphoribosyl-a-N-formylglycineamidineShow
YMDB16281N1-(5-phospho-β-D-ribosyl)glycinamideShow
GO Classification
Component
Not Available
Function
ATP binding
phosphoribosylaminoimidazole carboxylase activity
lyase activity
catalytic activity
carbon-carbon lyase activity
carboxy-lyase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
Process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
IMP biosynthetic process
'de novo' IMP biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR128C
Gene Sequence>1716 bp ATGGATTCTAGAACAGTTGGTATATTAGGAGGGGGACAATTGGGACGTATGATTGTTGAG GCAGCAAACAGGCTCAACATTAAGACGGTAATACTAGATGCTGAAAATTCTCCTGCCAAA CAAATAAGCAACTCCAATGACCACGTTAATGGCTCCTTTTCCAATCCTCTTGATATCGAA AAACTAGCTGAAAAATGTGATGTGCTAACGATTGAGATTGAGCATGTTGATGTTCCTACA CTAAAGAATCTTCAAGTAAAACATCCCAAATTAAAAATTTACCCTTCTCCAGAAACAATC AGATTGATACAAGACAAATATATTCAAAAAGAGCATTTAATCAAAAATGGTATAGCAGTT ACCCAAAGTGTTCCTGTGGAACAAGCCAGTGAGACGTCCCTATTGAATGTTGGAAGAGAT TTGGGTTTTCCATTCGTCTTGAAGTCGAGGACTTTGGCATACGATGGAAGAGGTAACTTC GTTGTAAAGAATAAGGAAATGATTCCGGAAGCTTTGGAAGTACTGAAGGATCGTCCTTTG TACGCCGAAAAATGGGCACCATTTACTAAAGAATTAGCAGTCATGATTGTGAGATCTGTT AACGGTTTAGTGTTTTCTTACCCAATTGTAGAGACTATCCACAAGGACAATATTTGTGAC TTATGTTATGCGCCTGCTAGAGTTCCGGACTCCGTTCAACTTAAGGCGAAGTTGTTGGCA GAAAATGCAATCAAATCTTTTCCCGGTTGTGGTATATTTGGTGTGGAAATGTTCTATTTA GAAACAGGGGAATTGCTTATTAACGAAATTGCCCCAAGGCCTCACAACTCTGGACATTAT ACCATTGATGCTTGCGTCACTTCTCAATTTGAAGCTCATTTGAGATCAATATTGGATTTG CCAATGCCAAAGAATTTCACATCTTTCTCCACCATTACAACGAACGCCATTATGCTAAAT GTTCTTGGAGACAAACATACAAAAGATAAAGAGCTAGAAACTTGCGAAAGAGCATTGGCG ACTCCAGGTTCCTCAGTGTACTTATATGGAAAAGAGTCTAGACCTAACAGAAAAGTAGGT CACATAAATATTATTGCCTCCAGTATGGCGGAATGTGAACAAAGGCTGAACTACATTACA GGTAGAACTGATATTCCAATCAAAATCTCTGTCGCTCAAAAGTTGGACTTGGAAGCAATG GTCAAACCATTGGTTGGAATCATCATGGGATCAGACTCTGACTTGCCGGTAATGTCTGCC GCATGTGCGGTTTTAAAAGATTTTGGCGTTCCATTTGAAGTGACAATAGTCTCTGCTCAT AGAACTCCACATAGGATGTCAGCATATGCTATTTCCGCAAGCAAGCGTGGAATTAAAACA ATTATCGCTGGAGCTGGTGGGGCTGCTCACTTGCCAGGTATGGTGGCTGCAATGACACCA CTTCCTGTCATCGGTGTGCCCGTAAAAGGTTCTTGTCTAGATGGAGTAGATTCTTTACAT TCAATTGTGCAAATGCCTAGAGGTGTTCCAGTAGCTACCGTCGCTATTAATAATAGTACG AACGCTGCGCTGTTGGCTGTCAGACTGCTTGGCGCTTATGATTCAAGTTATACAACGAAA ATGGAACAGTTTTTATTAAAGCAAGAAGAAGAAGTTCTTGTCAAAGCACAAAAGTTAGAA ACTGTCGGTTACGAAGCTTATCTAGAAAACAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues571
Protein Molecular Weight62338.69922
Protein Theoretical pI7.36
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoribosylaminoimidazole carboxylase MDSRTVGILGGGQLGRMIVEAANRLNIKTVILDAENSPAKQISNSNDHVNGSFSNPLDIE KLAEKCDVLTIEIEHVDVPTLKNLQVKHPKLKIYPSPETIRLIQDKYIQKEHLIKNGIAV TQSVPVEQASETSLLNVGRDLGFPFVLKSRTLAYDGRGNFVVKNKEMIPEALEVLKDRPL YAEKWAPFTKELAVMIVRSVNGLVFSYPIVETIHKDNICDLCYAPARVPDSVQLKAKLLA ENAIKSFPGCGIFGVEMFYLETGELLINEIAPRPHNSGHYTIDACVTSQFEAHLRSILDL PMPKNFTSFSTITTNAIMLNVLGDKHTKDKELETCERALATPGSSVYLYGKESRPNRKVG HINIIASSMAECEQRLNYITGRTDIPIKISVAQKLDLEAMVKPLVGIIMGSDSDLPVMSA ACAVLKDFGVPFEVTIVSAHRTPHRMSAYAISASKRGIKTIIAGAGGAAHLPGMVAAMTP LPVIGVPVKGSCLDGVDSLHSIVQMPRGVPVATVAINNSTNAALLAVRLLGAYDSSYTTK MEQFLLKQEEEVLVKAQKLETVGYEAYLENK
References
External Links
ResourceLink
Saccharomyces Genome Database ADE2
Uniprot IDP21264
Uniprot NamePUR6_YEAST
GenBank Gene IDM59824
Genebank Protein ID171003
General Reference
  • Stotz, A., Linder, P. (1990). "The ADE2 gene from Saccharomyces cerevisiae: sequence and new vectors." Gene 95:91-98.2253890
  • Sasnauskas, K., Jomantiene, R., Lebediene, E., Lebedys, J., Januska, A., Janulaitis, A. (1992). "Molecular cloning and analysis of autonomous replicating sequence of Candida maltosa." Yeast 8:253-259.1514324
  • Wiemann, S., Rechmann, S., Benes, V., Voss, H., Schwager, C., Vlcek, C., Stegemann, J., Zimmermann, J., Erfle, H., Paces, V., Ansorge, W. (1996). "Sequencing and analysis of 51 kb on the right arm of chromosome XV from Saccharomyces cerevisiae reveals 30 open reading frames." Yeast 12:281-288.8904341
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106