You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCholine kinase
SynonymsNot Available
Gene NameCKI1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, alcohol group as acceptor
Specific FunctionResponsible for phosphatidylcholine synthesis via the CDP-choline pathway. Also exhibits ethanolamine kinase activity but at 14% efficiency compared with choline
Cellular LocationCytoplasm
SMPDB Pathways
Lysolipid incorporation into ER PC(18:2(9Z,11Z)/18:2(9Z,11Z))PW002789 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))PW002790 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Choline + Adenosine triphosphateADP + hydron + Phosphorylcholine
KEGG Reactions
Adenosine triphosphate + CholinePhosphorylcholine + hydron + ADP
Adenosine triphosphate + Ethanolaminehydron + ADP + O-Phosphoethanolamine
Metabolites
YMDB IDNameView
YMDB00009EthanolamineShow
YMDB00109Adenosine triphosphateShow
YMDB00125O-PhosphoethanolamineShow
YMDB00191PhosphorylcholineShow
YMDB00227CholineShow
YMDB00862hydronShow
YMDB00914ADPShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLR133W
Gene Sequence>1749 bp ATGGTACAAGAATCACGTCCAGGGAGTGTAAGAAGTTACTCGGTCGGTTACCAAGCAAGG TCCAGATCGAGTTCTCAAAGAAGACATTCGTTAACACGCCAACGTTCCTCGCAAAGACTG ATTAGAACCATCAGTATCGAGTCTGATGTGTCTAATATTACTGACGATGACGATTTGAGA GCTGTCAATGAGGGAGTAGCGGGTGTGCAACTGGACGTCTCTGAAACCGCAAATAAGGGA CCAAGAAGAGCATCAGCAACTGATGTCACAGATAGTTTGGGTTCGACTTCGTCGGAATAT ATTGAGATTCCCTTTGTTAAGGAAACATTGGATGCAAGTTTACCTTCGGATTATCTGAAG CAGGACATATTAAATCTCATTCAGAGTTTGAAGATATCCAAATGGTATAACAACAAGAAA ATCCAACCGGTAGCACAAGATATGAACTTAGTCAAGATCTCTGGTGCGATGACAAACGCA ATTTTCAAAGTTGAATACCCTAAGTTACCATCGTTGCTATTGAGAATATACGGACCGAAT ATTGATAATATCATTGACAGGGAATATGAATTGCAGATTTTGGCTAGGCTTTCATTGAAA AATATAGGTCCTTCCCTTTACGGCTGTTTTGTAAACGGTAGATTTGAGCAGTTTCTGGAG AATTCTAAGACTTTAACAAAAGACGACATTAGAAACTGGAAGAACTCTCAAAGGATTGCA AGGAGAATGAAGGAGTTACATGTAGGTGTTCCTCTCTTGAGTTCAGAAAGGAAGAACGGG TCGGCTTGTTGGCAAAAGATTAACCAGTGGTTGCGCACGATTGAGAAAGTCGACCAATGG GTGGGGGATCCTAAAAACATTGAAAACTCTTTATTATGTGAGAATTGGTCCAAGTTTATG GATATTGTCGATAGATATCACAAGTGGCTTATTTCTCAAGAACAGGGTATAGAGCAAGTC AACAAAAATCTTATATTCTGCCATAATGATGCCCAATACGGCAATTTACTTTTCACTGCT CCTGTGATGAACACACCGAGCCTATACACTGCACCTTCGTCTACATCATTGACTTCCCAA TCAAGTTCCTTATTTCCTTCGAGCTCCAATGTCATTGTAGATGATATAATCAACCCGCCA AAGCAGGAGCAAAGCCAAGATTCCAAATTGGTCGTCATTGATTTTGAATATGCAGGTGCC AATCCCGCCGCATATGATTTAGCGAATCATCTTTCCGAGTGGATGTATGATTACAACAAT GCTAAGGCCCCACATCAGTGCCACGCTGATAGATATCCCGATAAAGAACAGGTTTTGAAT TTCTTATACTCTTATGTTTCGCATCTAAGGGGTGGTGCTAAGGAACCCATAGATGAAGAG GTTCAAAGACTCTATAAGTCAATCATTCAATGGAGACCCACTGTACAACTATTTTGGTCG CTCTGGGCCATCCTACAAAGTGGTAAATTAGAGAAAAAAGAAGCCTCCACTGCCATCACT AGAGAAGAAATTGGACCCAATGGAAAAAAATATATCATCAAGACTGAACCCGAATCCCCT GAAGAAGACTTTGTTGAAAATGACGACGAGCCTGAAGCTGGCGTCAGCATTGACACGTTC GATTATATGGCTTATGGTCGTGACAAGATTGCGGTCTTTTGGGGCGACCTCATTGGCTTA GGCATAATCACCGAAGAAGAATGCAAAAATTTCAGCTCTTTCAAGTTCCTCGATACTAGT TATTTGTAA
Protein Properties
Pfam Domain Function
Protein Residues582
Protein Molecular Weight66316.0
Protein Theoretical pI5.34
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Choline kinase MVQESRPGSVRSYSVGYQARSRSSSQRRHSLTRQRSSQRLIRTISIESDVSNITDDDDLR AVNEGVAGVQLDVSETANKGPRRASATDVTDSLGSTSSEYIEIPFVKETLDASLPSDYLK QDILNLIQSLKISKWYNNKKIQPVAQDMNLVKISGAMTNAIFKVEYPKLPSLLLRIYGPN IDNIIDREYELQILARLSLKNIGPSLYGCFVNGRFEQFLENSKTLTKDDIRNWKNSQRIA RRMKELHVGVPLLSSERKNGSACWQKINQWLRTIEKVDQWVGDPKNIENSLLCENWSKFM DIVDRYHKWLISQEQGIEQVNKNLIFCHNDAQYGNLLFTAPVMNTPSLYTAPSSTSLTSQ SSSLFPSSSNVIVDDIINPPKQEQSQDSKLVVIDFEYAGANPAAYDLANHLSEWMYDYNN AKAPHQCHADRYPDKEQVLNFLYSYVSHLRGGAKEPIDEEVQRLYKSIIQWRPTVQLFWS LWAILQSGKLEKKEASTAITREEIGPNGKKYIIKTEPESPEEDFVENDDEPEAGVSIDTF DYMAYGRDKIAVFWGDLIGLGIITEEECKNFSSFKFLDTSYL
References
External Links
ResourceLink
Saccharomyces Genome Database CKI1
Uniprot IDP20485
Uniprot NameKICH_YEAST
GenBank Gene IDAY692779
Genebank Protein ID51013009
General Reference
  • Hosaka, K., Kodaki, T., Yamashita, S. (1989). "Cloning and characterization of the yeast CKI gene encoding choline kinase and its expression in Escherichia coli." J Biol Chem 264:2053-2059.2536698
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Yu, Y., Sreenivas, A., Ostrander, D. B., Carman, G. M. (2002). "Phosphorylation of Saccharomyces cerevisiae choline kinase on Ser30 and Ser85 by protein kinase A regulates phosphatidylcholine synthesis by the CDP-choline pathway." J Biol Chem 277:34978-34986.12105205
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Calvert, M. E., Keck, K. M., Ptak, C., Shabanowitz, J., Hunt, D. F., Pemberton, L. F. (2008). "Phosphorylation by casein kinase 2 regulates Nap1 localization and function." Mol Cell Biol 28:1313-1325.18086883
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956