You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydroorotase
Synonyms
  • DHOase
Gene NameURA4
Enzyme Class
Biological Properties
General FunctionInvolved in dihydroorotase activity
Specific Function(S)-dihydroorotate + H(2)O = N-carbamoyl-L- aspartate
Cellular LocationCytoplasmic
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB Reactions
N-Carbamoyl-L-aspartate + hydronwater + 4,5-Dihydroorotic acid
KEGG Reactions
water + L-Dihydroorotic acidUreidosuccinic acid + hydron
Metabolites
YMDB IDNameView
YMDB00027Ureidosuccinic acidShow
YMDB00396L-Dihydroorotic acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB01008N-Carbamoyl-L-aspartateShow
YMDB161154,5-Dihydroorotic acidShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides
dihydroorotase activity
Process
metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
nucleobase metabolic process
pyrimidine base metabolic process
pyrimidine base biosynthetic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR420W
Gene Sequence>1095 bp ATGGTACAAGAAATCGATTTAGGTTTGACATGTGATATGCATGTTCATGTAAGAGAGGGT GCGATGTGTGAACTAGTCACCCCCAAGATTAGAGATGGTGGGGTTTCAATTGCTTACATC ATGCCAAATTTACAACCTCCAATTACCACACTAGATAGAGTGATTGAATACAAAAAGACA CTGCAGAAACTAGCTCCTAAAACTACCTTCTTAATGAGTTTTTATCTTTCAAAAGACTTA ACTCCAGATTTAATTCATGAAGCTGCCCAACAACATGCCATTCGTGGAGTAAAGTGTTAT CCAGCGGGAGTAACAACAAATTCGGCTGCTGGGGTGGATCCAAATGACTTCAGCGCATTT TACCCAATTTTCAAGGCTATGCAAGAAGAGAACCTGGTATTAAATTTGCATGGGGAAAAA CCTTCTGTCCATGATGGAGACAAAGAACCTATTCATGTATTGAATGCAGAGGAAGCCTTT TTGCCAGCCTTGAAAAAATTGCATAATGATTTCCCAAACCTGAAAATAATTCTGGAACAC TGCACTAGCGAGTCGGCAATAAAGACAATCGAGGATATAAATAAGAACGTGAAGAAAGCC ACTGACGTAAAGGTTGCTGCCACATTAACGGCTCATCACTTATTTTTAACAATTGATGAT TGGGCCGGAAATCCGGTAAATTTTTGCAAACCTGTTGCGAAACTTCCAAATGACAAAAAG GCTCTAGTCAAAGCTGCTGTATCAGGGAAACCATATTTTTTCTTTGGATCTGATTCAGCA CCTCATCCTGTACAAAATAAGGCCAATTACGAGGGTGTTTGCGCAGGAGTTTACTCACAA TCTTTTGCGATCCCTTATATCGCCCAAGTTTTTGAAGAGCAAAATGCCTTGGAGAACTTA AAGGGCTTTGTTTCCGACTTCGGAATTTCCTTTTATGAGGTTAAAGATAGCGAAGTGGCT TCTTCAGATAAGGCAATATTATTCAAAAAAGAACAAGTTATCCCTCAGGTTATCAGCGAT GGCAAAGACATAAGCATCATCCCATTTAAAGCAGGTGATAAACTAAGTTGGTCGGTGAGA TGGGAACCTCGTTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues364
Protein Molecular Weight40313.0
Protein Theoretical pI6.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydroorotase MVQEIDLGLTCDMHVHVREGAMCELVTPKIRDGGVSIAYIMPNLQPPITTLDRVIEYKKT LQKLAPKTTFLMSFYLSKDLTPDLIHEAAQQHAIRGVKCYPAGVTTNSAAGVDPNDFSAF YPIFKAMQEENLVLNLHGEKPSVHDGDKEPIHVLNAEEAFLPALKKLHNDFPNLKIILEH CTSESAIKTIEDINKNVKKATDVKVAATLTAHHLFLTIDDWAGNPVNFCKPVAKLPNDKK ALVKAAVSGKPYFFFGSDSAPHPVQNKANYEGVCAGVYSQSFAIPYIAQVFEEQNALENL KGFVSDFGISFYEVKDSEVASSDKAILFKKEQVIPQVISDGKDISIIPFKAGDKLSWSVR WEPR
References
External Links
ResourceLink
Saccharomyces Genome Database URA4
Uniprot IDP20051
Uniprot NamePYRC_YEAST
GenBank Gene IDU20162
Genebank Protein ID632670
General Reference
  • Guyonvarch, A., Nguyen-Juilleret, M., Hubert, J. C., Lacroute, F. (1988). "Structure of the Saccharomyces cerevisiae URA4 gene encoding dihydroorotase." Mol Gen Genet 212:134-141.2897615
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106