You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePrephenate dehydrogenase [NADP+]
Synonyms
  • PRDH
Gene NameTYR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionPrephenate + NADP(+) = 4-hydroxyphenylpyruvate + CO(2) + NADPH
Cellular LocationNot Available
SMPDB Pathways
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tyrosine metabolismec00350 Map00350
SMPDB Reactions
Prephenate + NADPNADPH + Carbon dioxide + (4-hydroxyphenyl)pyruvic acid
KEGG Reactions
NADP + PrephenateCarbon dioxide + (4-hydroxyphenyl)pyruvic acid + NADPH
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB001514-Hydroxyphenylpyruvic acidShow
YMDB00324PrephenateShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00912Carbon dioxideShow
YMDB00958(4-hydroxyphenyl)pyruvic acidShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
oxidoreductase activity, acting on the CH-CH group of donors
oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
prephenate dehydrogenase (NADP+) activity
catalytic activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
aromatic amino acid family metabolic process
tyrosine metabolic process
tyrosine biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR166C
Gene Sequence>1359 bp ATGGTATCAGAGGATAAGATTGAGCAATGGAAAGCCACAAAAGTCATTGGTATAATTGGT CTGGGTGATATGGGCCTATTATACGCTAATAAATTTACAGATGCTGGATGGGGTGTTATA TGTTGTGATAGGGAAGAATATTATGATGAACTGAAAGAAAAATATGCCTCAGCTAAATTC GAACTGGTGAAAAATGGTCATTTGGTATCCAGGCAAAGCGACTATATTATCTATAGTGTT GAAGCATCCAATATTAGTAAGATCGTCGCAACGTATGGACCATCTTCTAAGGTTGGAACA ATTGTTGGGGGTCAAACGAGTTGTAAGCTGCCGGAAATCGAGGCTTTCGAAAAGTATTTA CCCAAGGACTGCGACATCATTACCGTGCATTCCCTTCATGGGCCTAAAGTTAATACTGAA GGCCAACCACTAGTTATTATCAATCACAGATCACAGTACCCAGAATCTTTTGAGTTCGTT AATTCTGTTATGGCATGTTTGAAAAGTAAGCAAGTTTATTTGACATATGAAGAGCATGAC AAGATTACCGCTGATACACAAGCTGTGACACATGCTGCTTTCTTAAGTATGGGATCTGCG TGGGCAAAGATAAAGATTTATCCTTGGACTCTGGGTGTAAACAAATGGTACGGTGGCCTA GAAAATGTGAAAGTTAATATATCACTAAGAATCTATTCGAACAAGTGGCATGTTTACGCA GGATTAGCCATAACAAACCCAAGTGCACATCAGCAAATTCTTCAATATGCAACCAGTGCA ACAGAACTATTTAGTTTAATGATAGATAACAAAGAACAAGAACTTACTGATAGACTATTA AAAGCTAAGCAATTTGTATTTGGAAAGCATACTGGTCTCTTACTATTGGATGACACGATT TTAGAGAAATATTCGCTATCAAAAAGCAGCATTGGTAACAGCAACAATTGCAAGCCAGTG CCGAATTCACATTTATCATTGTTGGCGATTGTTGATTCGTGGTTTCAACTTGGTATTGAT CCATATGATCATATGATTTGTTCGACGCCATTATTCAGAATATTCCTGGGTGTGTCCGAA TATCTTTTTTTAAAACCTGGCTTATTAGAACAGACAATTGATGCAGCTATCCATGATAAA TCATTCATAAAAGATGATTTAGAATTTGTTATTTCGGCTAGAGAATGGAGCTCGGTTGTT TCTTTTGCCAATTTTGATATATACAAAAAGCAATTTCAGAGTGTTCAAAAGTTCTTTGAG CCAATGCTTCCAGAGGCTAATCTCATTGGCAACGAGATGATAAAAACCATTCTGAGTCAT TCTAGTGACCGTTCGGCCGCTGAAAAAAGAAATACATAA
Protein Properties
Pfam Domain Function
Protein Residues452
Protein Molecular Weight50922.89844
Protein Theoretical pI6.57
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Prephenate dehydrogenase [NADP+] MVSEDKIEQWKATKVIGIIGLGDMGLLYANKFTDAGWGVICCDREEYYDELKEKYASAKF ELVKNGHLVSRQSDYIIYSVEASNISKIVATYGPSSKVGTIVGGQTSCKLPEIEAFEKYL PKDCDIITVHSLHGPKVNTEGQPLVIINHRSQYPESFEFVNSVMACLKSKQVYLTYEEHD KITADTQAVTHAAFLSMGSAWAKIKIYPWTLGVNKWYGGLENVKVNISLRIYSNKWHVYA GLAITNPSAHQQILQYATSATELFSLMIDNKEQELTDRLLKAKQFVFGKHTGLLLLDDTI LEKYSLSKSSIGNSNNCKPVPNSHLSLLAIVDSWFQLGIDPYDHMICSTPLFRIFLGVSE YLFLKPGLLEQTIDAAIHDKSFIKDDLEFVISAREWSSVVSFANFDIYKKQFQSVQKFFE PMLPEANLIGNEMIKTILSHSSDRSAAEKRNT
References
External Links
ResourceLink
Saccharomyces Genome Database TYR1
Uniprot IDP20049
Uniprot NameTYR1_YEAST
GenBank Gene IDZ36035
Genebank Protein ID536506
General Reference
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mannhaupt, G., Stucka, R., Pilz, U., Schwarzlose, C., Feldmann, H. (1989). "Characterization of the prephenate dehydrogenase-encoding gene, TYR1, from Saccharomyces cerevisiae." Gene 85:303-311.2697638