You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDolichol kinase
SynonymsNot Available
Gene NameSEC59
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring phosphorus-containing groups
Specific FunctionInvolved in the synthesis of the sugar donor Dol-P-Man which is required in the synthesis of N-linked and O-linked oligosaccharides and for that of GPI anchors. It is required for spore germination. Has an essential role in cellular metabolism
Cellular LocationEndoplasmic reticulum membrane (Probable)
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB Reactions
Dolichol-20 + Cytidine triphosphateDolichol phosphate + hydron + CDP
KEGG Reactions
Dolichol-20 + Cytidine triphosphatedolichyl phosphate + CDP + hydron
Metabolites
YMDB IDNameView
YMDB00064CDPShow
YMDB00279Cytidine triphosphateShow
YMDB00862hydronShow
YMDB00864Dolichol phosphateShow
YMDB00928Dolichol-20Show
YMDB00941dolichyl phosphateShow
GO Classification
Component
cell part
membrane
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
Not Available
Gene Properties
Chromosome Locationchromosome 13
LocusYMR013C
Gene Sequence>1560 bp ATGGTCGCTATAATACCTCATGCTTCCTTTACCACAATTAAACTAACCCAGAAAACTGAG GGAAGCCAAATGCCAACTGAGGAGATCTGCAAAATCAATATGAGGACTCGTAAATTTGAT GTGGGCGGGAATTCTCGAGATTTTGAGTGCTTTTATTCGAATTTTGTTCAAACTGTTATA TTGTTGGGCACTTTTTTTTACTGTGTTGAAAGGCTTCAGCCGTGGTCCATTGTTACCGCT GATATATCTTATAAACAAATCTTTGTAAATGTCTTTGTGGTGTGTTTGATAATGGTTGGT CTGATATTCACAAAATATTGGCAACATGGTTACAAAAGCCTACCCAAGTTCGATACCATT TACAGTTTATATTTACCGTTTATGGTTTCGTTGTTGTTCGATACATCATCTACGGTGATA AATACTATTTTGATCCTTTCGGTATTAAATTCATATAGATGGCGAACTCAGTTGGTAGTG ATCATTTTACAGCTCTGCCTCATATTTTTTAATTTTGAGGCTGGTGACAGGTTAAAGAAT ATTATTAGCATAGTAATAAATTCTTTACTGTCGTTAATTTTGAAGTATATTGGGCAATTG AAAAGTTTAGATAATATCGACTCTAATCTTTTTAGTATCCTATTAACCAATATTCTGTAC GTTTCAGAGGCTGGCACAGTACATTTTAGAATTTTGAAGGGCATTATCCTTGCTCTCACA ACAATAATTTCAATTAACTATGTGCTCAAAAAGGTAATGCACTTTAAACCGTTTATGCTG TCAATATCCTTTGCCATCGGGCTTCCACTTTTTGCCAATACCTTCATTCATTTAGAAGAC GGTGAAAATCCGCTACTTTGGCTGGTAAAATATATCTTAGAGTCTACTATTCGTCAAAAG ATTTTGTTTGCTTGGTCTTCAATTCTTATACTGTCCATACCAAGTATATTGATCGAGAAG GACAGTCTATCGTTGAACACCTCCCGAAAATTGTGGCATTTCATCATTTTCTTACTCATA ATACCGTCATTCCAAATGGATTCAAACTTTGTGAAAATTGCATTGTCCGGAACAATACCA GTCTTCTTATCAATTGAGTACATAAGATTTCAAAACCTACCGCCGTTAGGATCTGCTATT GAATTACAACTAAGAAGGTTTGCTGATGATAGGGACCACAGCGGGCCATTGATCATATCA TACCTTTATTTACTCTTCGGAATATCAACACCTTTATTAATGAATAACTCTCCAATGGGT CTAATAGGATTGGGAATTGGTGATTCCTTAGCATCTATTATTGGTAAAAGGTATGGCCGC ATTCGTTGGAAAGGTACACAAAAAACTTTAGAGGGAACTCTTGCGTTTATAGTAACGAGT TTTATCGTTTGTTTGGTATTGTTACGTTTTGATAAAGCTGCAATTTTTAACCACCTAACT ACTTTACAATTGCTTACCCTTTGTACACTGAGTGGAGTGCTAGAAGGTAATAGTGTGCTT AATGACAATATTTTGATACCTGCATTTATGATGATTTGTGAAAAATTAATTACTCTTTGA
Protein Properties
Pfam Domain Function
Protein Residues519
Protein Molecular Weight58905.39844
Protein Theoretical pI9.22
Signalling Regions
  • None
Transmembrane Regions
  • 48-68
  • 89-109
  • 119-139
  • 152-172
  • 182-203
  • 224-244
  • 254-274
  • 295-315
  • 327-347
  • 350-370
  • 395-415
  • 418-438
  • 450-470
  • 473-493
Protein Sequence>Dolichol kinase MVAIIPHASFTTIKLTQKTEGSQMPTEEICKINMRTRKFDVGGNSRDFECFYSNFVQTVI LLGTFFYCVERLQPWSIVTADISYKQIFVNVFVVCLIMVGLIFTKYWQHGYKSLPKFDTI YSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTQLVVIILQLCLIFFNFEAGDRLKN IISIVINSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFRILKGIILALT TIISINYVLKKVMHFKPFMLSISFAIGLPLFANTFIHLEDGENPLLWLVKYILESTIRQK ILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFIIFLLIIPSFQMDSNFVKIALSGTIP VFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTPLLMNNSPMG LIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVLLRFDKAAIFNHLT TLQLLTLCTLSGVLEGNSVLNDNILIPAFMMICEKLITL
References
External Links
ResourceLink
Saccharomyces Genome Database SEC59
Uniprot IDP20048
Uniprot NameSEC59_YEAST
GenBank Gene IDAY692829
Genebank Protein ID51013109
General Reference
  • Bernstein, M., Kepes, F., Schekman, R. (1989). "Sec59 encodes a membrane protein required for core glycosylation in Saccharomyces cerevisiae." Mol Cell Biol 9:1191-1199.2657387
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Heller, L., Orlean, P., Adair, W. L. Jr (1992). "Saccharomyces cerevisiae sec59 cells are deficient in dolichol kinase activity." Proc Natl Acad Sci U S A 89:7013-7016.1323123
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956