You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name4-nitrophenylphosphatase
Synonyms
  • PNPPase
Gene NamePHO13
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionPHO13 is dispensable for vegetative growth and sporulation
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB002484-Nitrophenyl phosphateShow
YMDB003164-NitrophenolShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
phosphatase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL236W
Gene Sequence>939 bp ATGACTGCTCAACAAGGTGTACCAATAAAGATAACCAATAAGGAGATTGCTCAAGAATTC TTGGACAAATATGACACGTTTCTGTTCGATTGTGATGGTGTATTATGGTTAGGTTCTCAA GCATTACCATACACCCTGGAAATTCTAGACCTTTTGAAGCAATTGGGCAAACAACTGATC TTCGTTACGAATAACTCTACCAAGTCCCGTTTAGCATACACGAAAAAGTTTGCTTCGTTT GGTATTGATGTCAAAGAAGAACAGATTTTCACCTCTGGTTATGCGCCAGCTGTTTATATT CGTGACTTTCTGAAATTGCAGCCTGGCAAAGATAAGGTATGGGTATTTGGAGAAAGCGGT ATTGGTGAAGAATTGAAACTAATGGGGTACGAATCTCTAGGAGGTGCCGATTCCAGATTG GATACGCCGTTCGATGCAGCTAAATCACCATTTTTGGTGAACGGCCTTGATAAGGATGTT AGTTGTGTTATTGCTGGGTTAGACACGAAGGTAAATTACCACCGTTTGGCTGTTACACTG CAGTATTTGCAGAAGGATTCTGTTCACTTTGTTGGTACAAATGTTGATTCTACTTTCCCG CAAAAGGGTTATACATTTCCCGGTGCAGGCTCCATGATTGAATCATTGGCATTCTCATCT AATAGGAGGCCATCGTACTGTGGTAAGCCAAATCAAAATATGCTAAACAGCATTATATCG GCATTCAACCTGGATAGATCAAAGTGCTGTATGGTTGGTGACAGATTAAACACCGATATG AAATTCGGTGTTGAAGGTGGGTTAGGTGGCACACTACTCGTTTTGAGTGGTATTGAAACC GAAGAGAGAACCTTGAAGATTTCGCACGATTATCCAAGACCTAAATTTTACATTGATAAA CTTGGTGACATCTACGCCTTAACCAATAATGAGTTATAG
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight34624.30078
Protein Theoretical pI6.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>4-nitrophenylphosphatase MTAQQGVPIKITNKEIAQEFLDKYDTFLFDCDGVLWLGSQALPYTLEILNLLKQLGKQLI FVTNNSTKSRLAYTKKFASFGIDVKEEQIFTSGYASAVYIRDFLKLQPGKDKVWVFGESG IGEELKLMGYESLGGADSRLDTPFDAAKSPFLVNGLDKDVSCVIAGLDTKVNYHRLAVTL QYLQKDSVHFVGTNVDSTFPQKGYTFPGAGSMIESLAFSSNRRPSYCGKPNQNMLNSIIS AFNLDRSKCCMVGDRLNTDMKFGVEGGLGGTLLVLSGIETEERALKISHDYPRPKFYIDK LGDIYTLTNNEL
References
External Links
ResourceLink
Saccharomyces Genome Database PHO13
Uniprot IDP19881
Uniprot NamePNPP_YEAST
GenBank Gene IDX51611
Genebank Protein ID5924022
General Reference
  • Kaneko, Y., Toh-e, A., Banno, I., Oshima, Y. (1989). "Molecular characterization of a specific p-nitrophenylphosphatase gene, PHO13, and its mapping by chromosome fragmentation in Saccharomyces cerevisiae." Mol Gen Genet 220:133-139.2558283
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956