You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCholine transport protein
SynonymsNot Available
Gene NameHNM1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionSole choline transporter in yeast
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00227CholineShow
YMDB00862hydronShow
GO Classification
Component
membrane
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 7
LocusYGL077C
Gene Sequence>1692 bp ATGAGTATACGGAATGATAATGCTTCCGGTGGCTATATGCAGCCGGATCAATCTTCGAAC GCTTCTATGCACAAAAGAGACTTAAGAGTTGAGGAGGAAATAAAGCCATTGGATGATATG GATAGCAAGGGTGCTGTAGCAGCAGATGGTGAAGTTCATCTAAGAAAGTCATTTTCGTTG TGGTCAATTCTTGGTGTTGGATTCGGTTTGACTAATTCCTGGTTCGGTATTTCTACATCG ATGGTTGCAGGTATATCTTCTGGTGGACCCATGATGATTGTTTACGGTATAATTATTGTT GCCCTGATTTCTATTTGCATTGGTACCTCGTTGGGTGAATTATCTTCCGCATATCCGCAC GCCGGTGGTCAGTTTTGGTGGTCTTTGAAGCTTGCCCCTCCTAAGTACAAAAGATTTGCG GCCTACATGTGCGGTTCATTTGCTTACGCAGGATCCGTGTTCACAAGTGCTTCAACTACG TTATCCGTTGCTACCGAAGTGGTTGGTATGTACGCTCTGACGCACCCTGAATTCATCCCA AAGAGATGGCATATATTCGTTTGCTTTGAATTGTTGCATTTGTTCTTGATGTTTTTCAAC TGTTACGGTAAATCCTTACCTATCATTTCATCTTCCTCTCTATACATTTCCCTACTATCC TTTTTCACAATTACAATTACTGTATTGGCATGTTCTCATGGAAAGTTCAACGATGCAAAG TTTGTTTTTGCCACATTTAATAATGAAACAGGTTGGAAGAACGGCGGTATCGCCTTTATT GTCGGTTTGATTAACCCAGCTTGGTCATTTTCGTGCCTTGACTGTGCAACCCATATGGCG TTTGAAGTTGAAAAACCAGAAAGAGTTATTCCCATTGCTATCATGGGAACAGTCGCCATT GGGTTTGTCACTTCCTTTTGTTATGTTATCGCTATGTTCTTCTCTATACAAGATCTGGAC GCTGTCTTGTCTTCTACAACAGGCGCCCCAATCTTGGACATTTATAATCAGGCATTGGGT AATAAATCAGGTGCGATTTTCCTGGGTTGCTTGATTCTATTTACCTCTTTTGGTTGCGTC ATTGCTTGTCACACTTGGCAGGCAAGGTTATGTTGGTCATTTGCCAGGGACAATGGTCTT CCATTATCCCGTTTATGGTCGCAAGTTAACCCACACACTGGTGTACCTTTGAACGCTCAT TTAATGTCATGCGCTTGGATAACCCTCATTGGCCTACTTTATTTGGCTTCCAGTACGGCT TTTCAGTCCTTAATTACAGGTTGTATTGCATTTTTATTGTTATCCTACATCATTCCGGTT ATATGTTTACTTGCTAAAAAGCGTAACATAGCTCATGGTCCATTCTGGCTTGGAAAATTT GGATTTTTTTCAAACATTGTTCTTTTGGGTTGGACTGTCTTTTCTGTGGTCTTTTTTTCC TTTCCACCAGTTTTACCTGTGACAAAGGATAACATGAACTATGTTTGTGTAGTTATTGTT GGTTATACTGCGTATTCGATTCTTTACTGGAAATACAAGGGTAAGAAGGAATTCCACGCT TTAGAAGAATCTGAGAACGAACAGGCTGAATATAGTAATAACTTCGATACCATTGAAGAT AGTCGAGAATTTTCCGTTGCGGCCTCTGACGTTGAACTCGAAAATGAACACGTACCGTGG GGAAAGAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues563
Protein Molecular Weight62055.39844
Protein Theoretical pI6.85
Signalling Regions
  • None
Transmembrane Regions
  • 58-78
  • 88-108
  • 183-203
  • 206-226
  • 256-276
  • 294-314
  • 343-363
  • 399-417
  • 427-445
  • 466-486
  • 492-512
Protein Sequence>Choline transport protein MSIRNDNASGGYMQPDQSSNASMHKRDLRVEEEIKPLDDMDSKGAVAADGEVHLRKSFSL WSILGVGFGLTNSWFGISTSMVAGISSGGPMMIVYGIIIVALISICIGTSLGELSSAYPH AGGQFWWSLKLAPPKYKRFAAYMCGSFAYAGSVFTSASTTLSVATEVVGMYALTHPEFIP KRWHIFVCFELLHLFLMFFNCYGKSLPIISSSSLYISLLSFFTITITVLACSHGKFNDAK FVFATFNNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAFEVEKPERVIPIAIMGTVAI GFVTSFCYVIAMFFSIQDLDAVLSSTTGAPILDIYNQALGNKSGAIFLGCLILFTSFGCV IACHTWQARLCWSFARDNGLPLSRLWSQVNPHTGVPLNAHLMSCAWITLIGLLYLASSTA FQSLITGCIAFLLLSYIIPVICLLAKKRNIAHGPFWLGKFGFFSNIVLLGWTVFSVVFFS FPPVLPVTKDNMNYVCVVIVGYTAYSILYWKYKGKKEFHALEESENEQAEYSNNFDTIED SREFSVAASDVELENEHVPWGKK
References
External Links
ResourceLink
Saccharomyces Genome Database HNM1
Uniprot IDP19807
Uniprot NameHNM1_YEAST
GenBank Gene IDAY723806
Genebank Protein ID51830315
General Reference
  • Nikawa, J., Hosaka, K., Tsukagoshi, Y., Yamashita, S. (1990). "Primary structure of the yeast choline transport gene and regulation of its expression." J Biol Chem 265:15996-16003.2203793
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258