You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePlasma membrane ATPase 2
Synonyms
  • Proton pump 2
Gene NamePMA2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThe plasma membrane ATPase of plants and fungi is a hydrogen ion pump. The proton gradient it generates drives the active transport of nutrients by H(+)-symport. The resulting external acidification and/or internal alkinization may mediate growth responses
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
ion transmembrane transporter activity
ATPase activity, coupled to transmembrane movement of ions
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
binding
hydrolase activity, acting on acid anhydrides
nucleoside binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
catalytic activity
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
transporter activity
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
transmembrane transporter activity
pyrophosphatase activity
nucleoside-triphosphatase activity
ATPase activity
hydrolase activity
substrate-specific transmembrane transporter activity
Process
nucleoside phosphate metabolic process
ion transport
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
cation transport
metabolic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
establishment of localization
nitrogen compound metabolic process
transport
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL036W
Gene Sequence>2844 bp ATGTCTTCCACTGAAGCAAAGCAATACAAGGAGAAACCCTCGAAAGAGTACCTCCATGCC AGTGATGGCGATGACCCTGCAAATAATTCTGCCGCTTCTTCGTCATCTTCGTCTTCTACA TCAACTTCCGCCTCGTCATCGGCTGCAGCCGTTCCACGGAAGGCCGCAGCCGCTTCTGCC GCTGATGATTCTGACTCAGATGAAGATATAGACCAATTGATTGATGAACTACAATCTAAC TACGGTGAGGGTGATGAATCTGGTGAAGAAGAAGTACGTACTGATGGGGTGCACGCTGGC CAAAGGGTTGTTCCTGAAAAGGACCTTTCTACGGACCCTGCGTATGGTTTGACTTCGGAT GAAGTCGCCAGGAGAAGAAAGAAATATGGGTTAAATCAAATGGCTGAGGAGAATGAATCG TTGATTGTGAAGTTTTTGATGTTCTTCGTAGGGCCTATTCAATTCGTTATGGAGGCTGCT GCTATTTTGGCTGCCGGTTTGTCTGATTGGGTTGATGTCGGTGTCATCTGTGCTTTACTG CTATTAAACGCATCTGTCGGATTTATTCAAGAATTCCAGGCAGGTTCCATCGTAGACGAG CTGAAAAAGACGTTGGCCAATACTGCAACAGTTATTAGAGATGGCCAATTGATCGAAATT CCGGCTAATGAGGTAGTTCCTGGTGAGATTTTGCAATTGGAAAGTGGCACAATTGCTCCC GCAGATGGTCGTATTGTCACTGAAGACTGTTTTTTGCAGATCGATCAATCGGCCATCACT GGTGAATCCTTAGCCGCTGAAAAGCATTACGGTGATGAGGTGTTCTCCTCATCCACTGTG AAAACCGGCGAGGCTTTTATGGTTGTTACTGCCACTGGTGACAATACCTTCGTCGGTAGG GCTGCCGCCTTAGTGGGGCAGGCTTCCGGTGTAGAGGGCCATTTCACTGAAGTATTGAAT GGAATTGGTATTATCTTACTTGTTCTAGTTATCGCTACTTTGTTGTTGGTCTGGACCGCA TGTTTCTATAGAACGGTCGGTATTGTAAGCATTTTGAGATATACTTTGGGTATAACCATC ATTGGTGTCCCAGTCGGTTTGCCAGCAGTTGTTACCACGACCATGGCTGTCGGTGCAGCT TACTTGGCTAAGAAGCAAGCCATTGTTCAAAAGTTATCTGCTATTGAATCCCTTGCTGGT GTTGAGATTTTATGTTCTGACAAGACTGGTACTTTAACCAAAAACAAGTTATCTTTACAC GAACCCTACACTGTCGAAGGCGTTTCTCCGGACGACTTGATGTTGACCGCTTGTTTAGCT GCCTCTAGAAAGAAGAAAGGTTTGGATGCTATTGATAAGGCTTTTTTGAAGTCATTGATT GAGTATCCAAAAGCTAAAGACGCCCTGACCAAGTACAAAGTTTTGGAATTCCATCCGTTC GACCCTGTCTCAAAAAAGGTTACCGCTGTTGTAGAATCCCCAGAAGGTGAAAGAATTGTT TGTGTCAAGGGAGCCCCATTGTTTGTCTTGAAGACTGTTGAAGAAGATCACCCAATTCCG GAAGATGTGCATGAAAACTACGAAAATAAGGTTGCTGAACTAGCTTCTAGAGGTTTCCGT GCTTTAGGTGTTGCTAGAAAGAGAGGGGAAGGTCACTGGGAAATCTTGGGTGTTATGCCA TGTATGGACCCCCCTAGAGATGACACCGCTCAAACAATCAATGAGGCCAGAAACCTTGGT TTGAGAATCAAGATGTTAACCGGTGACGCTGTTGGTATCGCGAAAGAAACGTGTAGGCAA TTAGGACTTGGTACAAACATTTATAACGCAGAAAGGTTAGGTCTGGGAGGTGGAGGTGAT ATGCCTGGTTCAGAGTTGGCTGATTTTGTTGAAAATGCCGATGGTTTCGCAGAAGTTTTC CCACAGCATAAATACAGAGTCGTTGAAATCTTGCAAAACAGAGGTTACTTGGTTGCTATG ACTGGTGATGGTGTTAACGATGCCCCATCTTTGAAGAAGGCTGATACTGGTATTGCTGTC GAAGGTGCTACCGATGCTGCCAGATCAGCCGCTGATATTGTTTTCTTGGCCCCTGGTCTC TCTGCTATTATTGATGCCTTAAAGACTTCTAGACAGATTTTCCACAGAATGTACTCCTAT GTTGTTTATCGTATTGCCCTATCCTTACATTTGGAGATTTTCCTGGGTTTATGGATTGCT ATTTTAAACAACTCTTTGGATATCAATTTGATCGTTTTTATTGCTATTTTCGCAGACGTT GCCACTTTAACTATTGCTTATGACAATGCTCCTTATGCTCCTGAACCTGTGAAATGGAAC CTACCAAGATTATGGGGTATGTCTATTATTTTGGGCATAGTTTTAGCTATAGGTTCTTGG ATTACTTTAACCACCATGTTCTTGCCTAATGGTGGTATTATCCAAAATTTTGGTGCCATG AATGGTGTCATGTTCCTGCAGATTTCACTAACTGAAAATTGGTTAATTTTTGTCACTAGA GCTGCTGGCCCATTCTGGTCTTCCATTCCATCGTGGCAGTTAGCCGGTGCCGTTTTCGCC GTTGATATTATTGCTACCATGTTTACCTTATTTGGCTGGTGGTCTGAAAACTGGACTGAT ATTGTGTCAGTCGTTCGTGTCTGGATTTGGTCCATTGGTATTTTTTGTGTATTGGGAGGA TTTTACTATATTATGTCCACGTCTCAAGCCTTTGATAGGTTGATGAATGGTAAGTCATTA AAGGAAAAGAAGTCTACAAGAAGTGTCGAAGATTTCATGGCTGCTATGCAAAGAGTTTCT ACTCAACACGACAAAAGCAGTTAG
Protein Properties
Pfam Domain Function
Protein Residues947
Protein Molecular Weight102171.0
Protein Theoretical pI4.66
Signalling Regions
  • None
Transmembrane Regions
  • 145-165
  • 170-189
  • 321-342
  • 354-376
  • 749-767
  • 784-803
  • 854-874
  • 887-903
Protein Sequence>Plasma membrane ATPase 2 MSSTEAKQYKEKPSKEYLHASDGDDPANNSAASSSSSSSTSTSASSSAAAVPRKAAAASA ADDSDSDEDIDQLIDELQSNYGEGDESGEEEVRTDGVHAGQRVVPEKDLSTDPAYGLTSD EVARRRKKYGLNQMAEENESLIVKFLMFFVGPIQFVMEAAAILAAGLSDWVDVGVICALL LLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEVVPGEILQLESGTIAP ADGRIVTEDCFLQIDQSAITGESLAAEKHYGDEVFSSSTVKTGEAFMVVTATGDNTFVGR AAALVGQASGVEGHFTEVLNGIGIILLVLVIATLLLVWTACFYRTVGIVSILRYTLGITI IGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLH EPYTVEGVSPDDLMLTACLAASRKKKGLDAIDKAFLKSLIEYPKAKDALTKYKVLEFHPF DPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFR ALGVARKRGEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQ LGLGTNIYNAERLGLGGGGDMPGSELADFVENADGFAEVFPQHKYRVVEILQNRGYLVAM TGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSY VVYRIALSLHLEIFLGLWIAILNNSLDINLIVFIAIFADVATLTIAYDNAPYAPEPVKWN LPRLWGMSIILGIVLAIGSWITLTTMFLPNGGIIQNFGAMNGVMFLQISLTENWLIFVTR AAGPFWSSIPSWQLAGAVFAVDIIATMFTLFGWWSENWTDIVSVVRVWIWSIGIFCVLGG FYYIMSTSQAFDRLMNGKSLKEKKSTRSVEDFMAAMQRVSTQHEKSS
References
External Links
ResourceLink
Saccharomyces Genome Database PMA2
Uniprot IDP19657
Uniprot NamePMA2_YEAST
GenBank Gene IDJ04421
Genebank Protein ID295644
General Reference
  • Schlesser, A., Ulaszewski, S., Ghislain, M., Goffeau, A. (1988). "A second transport ATPase gene in Saccharomyces cerevisiae." J Biol Chem 263:19480-19487.2904437
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358