You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAconitate hydratase, mitochondrial
Synonyms
  • Aconitase
  • Citrate hydro-lyase
Gene NameACO1
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionRequired for growth on nonfermentable carbon sources and for biosynthesis of glutamate
Cellular LocationMitochondrion. Cytoplasm.
SMPDB Pathways
Glyoxylate cyclePW002419 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glyoxylate and dicarboxylate metabolismec00630 Map00630
SMPDB Reactions
Citric acidwater + cis-aconitic acid
cis-aconitic acid + waterD-threo-Isocitric acid
KEGG Reactions
cis-aconitic acid + waterIsocitric acid
Citric acidcis-aconitic acid + water
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00086Citric acidShow
YMDB00630cis-aconitic acidShow
YMDB00890waterShow
YMDB16142D-threo-Isocitric acidShow
GO Classification
Component
Not Available
Function
catalytic activity
lyase activity
binding
metal cluster binding
iron-sulfur cluster binding
carbon-oxygen lyase activity
hydro-lyase activity
4 iron, 4 sulfur cluster binding
aconitate hydratase activity
Process
acetyl-CoA catabolic process
tricarboxylic acid cycle
metabolic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
acetyl-CoA metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR304C
Gene Sequence>2337 bp ATGCTGTCTGCACGTTCTGCCATCAAGAGACCCATTGTTCGTGGTCTTGCGACAGTCTCC AACTTGACTAGAGATTCAAAAGTCAACCAAAACTTATTAGAAGATCATTCTTTTATTAAC TACAAGCAGAATGTGGAAACGCTGGATATCGTAAGAAAAAGATTAAACAGGCCATTTACC TACGCGGAAAAGATTTTGTACGGTCACTTGGATGACCCTCATGGTCAAGATATTCAGAGA GGTGTTTCATACCTAAAATTAAGACCAGATCGTGTTGCCTGTCAAGATGCTACTGCTCAA ATGGCTATTTTACAATTTATGTCCGCTGGTTTACCACAGGTTGCTAAGCCAGTCACTGTC CACTGTGACCATTTGATTCAAGCACAAGTTGGTGGTGAAAAAGATTTGAAGAGAGCTATA GATCTAAACAAGGAAGTTTATGATTTCTTGGCCTCTGCCACTGCGAAATATAACATGGGT TTCTGGAAGCCAGGTTCCGGTATCATTCACCAAATTGTTCTGGAAAACTACGCTTTCCCA GGTGCTTTGATCATTGGTACTGACTCCCATACACCAAATGCTGGTGGTTTAGGTCAATTG GCTATTGGTGTTGGTGGTGCTGATGCCGTTGATGTTATGGCAGGTCGTCCATGGGAATTG AAGGCTCCAAAGATCTTAGGTGTTAAGTTGACTGGTAAGATGAACGGTTGGACTTCTCCA AAGGATATTATTTTGAAATTGGCTGGTATCACAACTGTCAAAGGTGGTACTGGTAAAATT GTTGAATATTTCGGTGATGGTGTTGACACCTTCTCCGCTACTGGTATGGGTACCATTTGT AATATGGGTGCTGAAATCGGTGCTACCACATCTGTTTTCCCATTCAACAAATCTATGATT GAATATTTGGAAGCAACTGGTCGTGGTAAGATCGCTGACTTTGCTAAATTATACCACAAG GACCTATTATCTGCTGATAAGGATGCTGAATACGATGAGGTCGTCGAAATTGACTTGAAC ACTCTGGAACCATACATCAATGGGCCATTTACCCCCGATTTGGCTACTCCAGTTTCTAAG ATGAAGGAAGTTGCTGTTGCTAATAACTGGCCATTGGATGTCAGAGTCGGTTTGATCGGT TCTTGTACCAATTCCTCTTATGAAGATATGTCTCGTTCAGCATCCATTGTCAAGGATGCT GCTGCTCATGGTTTGAAATCCAAGACCATTTTCACTGTTACTCCAGGTTCTGAACAAATC AGAGCCACTATTGAACGTGATGGCCAATTAGAAACCTTCAAAGAATTTGGTGGTATCGTT TTGGCAAACGCCTGTGGCCCATGTATTGGTCAATGGGATCGTAGAGATATCAAGAAAGGT GACAAGAATACTATCGTTTCCTCTTACAACAGAAATTTCACTTCTAGAAATGATGGTAAC CCACAAACTCATGCTTTTGTTGCATCTCCAGAATTAGTAACTGCGTTCGCCATTGCGGGT GATTTGAGATTCAACCCTCTAACAGACAAATTAAAGGACAAGGATGGTAATGAGTTCATG TTGAAACCACCACATGGTGATGGTTTGCCTCAAAGAGGTTATGATGCTGGTGAGAACACT TACCAAGCTCCACCTGCAGACCGTAGCACCGTTGAAGTTAAAGTTTCTCCAACTTCAGAC CGTCTACAACTGTTGAAACCATTCAAACCTTGGGATGGTAAGGATGCTAAAGACATGCCA ATCTTGATTAAGGCCGTCGGTAAGACAACTACTGATCATATTTCTATGGCTGGTCCATGG TTGAAATACAGAGGTCATTTAGAAAACATTTCTAATAACTATATGATTGGTGCTATTAAT GCTGAAAACAAGAAGGCTAACTGTGTTAAAAATGTATATACTGGTGAATACAAAGGTGTT CCAGACACTGCTAGAGATTACAGAGACCAAGGTATCAAGTGGGTTGTTATTGGTGATGAA AACTTTGGTGAAGGTTCCTCTCGTGAACACGCTGCTTTGGAACCAAGATTCTTGGGCGGT TTCGCTATCATCACAAAGTCTTTCGCTCGTATCCATGAAACTAACTTGAAAAAACAAGGT CTATTGCCATTGAACTTCAAGAACCCAGCTGACTATGACAAGATCAACCCTGATGACAGA ATCGATATTCTGGGTCTAGCTGAATTGGCTCCAGGTAAGCCTGTAACAATGAGAGTTCAT CCAAAGAATGGTAAGCCATGGGATGCTGTGTTGACCCATACTTTCAACGATGAGCAAATT GAATGGTTCAAATATGGTTCTGCCTTAAATAAAATTAAGGCCGATGAGAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues778
Protein Molecular Weight85367.5
Protein Theoretical pI8.24
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aconitate hydratase, mitochondrial MLSARSAIKRPIVRGLATVSNLTRDSKVNQNLLEDHSFINYKQNVETLDIVRKRLNRPFT YAEKILYGHLDDPHGQDIQRGVSYLKLRPDRVACQDATAQMAILQFMSAGLPQVAKPVTV HCDHLIQAQVGGEKDLKRAIDLNKEVYDFLASATAKYNMGFWKPGSGIIHQIVLENYAFP GALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMAGRPWELKAPKILGVKLTGKMNGWTSP KDIILKLAGITTVKGGTGKIVEYFGDGVDTFSATGMGTICNMGAEIGATTSVFPFNKSMI EYLEATGRGKIADFAKLYHKDLLSADKDAEYDEVVEIDLNTLEPYINGPFTPDLATPVSK MKEVAVANNWPLDVRVGLIGSCTNSSYEDMSRSASIVKDAAAHGLKSKTIFTVTPGSEQI RATIERDGQLETFKEFGGIVLANACGPCIGQWDRRDIKKGDKNTIVSSYNRNFTSRNDGN PQTHAFVASPELVTAFAIAGDLRFNPLTDKLKDKDGNEFMLKPPHGDGLPQRGYDAGENT YQAPPADRSTVEVKVSPTSDRLQLLKPFKPWDGKDAKDMPILIKAVGKTTTDHISMAGPW LKYRGHLENISNNYMIGAINAENKKANCVKNVYTGEYKGVPDTARDYRDQGIKWVVIGDE NFGEGSSREHAALEPRFLGGFAIITKSFARIHETNLKKQGLLPLNFKNPADYDKINPDDR IDILGLAELAPGKPVTMRVHPKNGKPWDAVLTHTFNDEQIEWFKYGSALNKIKADEKK
References
External Links
ResourceLink
Saccharomyces Genome Database ACO1
Uniprot IDP19414
Uniprot NameACON_YEAST
GenBank Gene IDU17243
Genebank Protein ID596052
General Reference
  • Gangloff, S. P., Marguet, D., Lauquin, G. J. (1990). "Molecular cloning of the yeast mitochondrial aconitase gene (ACO1) and evidence of a synergistic regulation of expression by glucose plus glutamate." Mol Cell Biol 10:3551-3561.1972545
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956