| Identification |
|---|
| Name | Guanine nucleotide-binding protein subunit gamma |
|---|
| Synonyms | Not Available |
|---|
| Gene Name | STE18 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | positive regulation of catalytic activity |
|---|
| Specific Function | Implicated in the pheromone A- and alpha-factor response pathway. The beta and gamma chains of the putative yeast mating response pathway G protein play a positive role in initiation of the mating response. |
|---|
| Cellular Location | Not Available |
|---|
| SMPDB Pathways | | Stress-activated signalling pathways: pheromone stress test 1 | PW012843 |    |
|
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Function |
|---|
| pheromone-dependent signal transduction involved in conjugation with cellular fusion | | cytoplasm | | plasma membrane | | heterotrimeric G-protein complex | | signal transducer activity | | heterotrimeric G-protein complex cycle | | adenylate cyclase-activating G-protein coupled receptor signaling pathway | | cAMP-mediated signaling | | positive regulation of catalytic activity |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >333 bp
ATGACATCAGTTCAAAACTCTCCACGCTTACAACAACCTCAGGAACAGCAACAGCAACAG
CAACAGCTTTCCTTAAAGATAAAACAATTGAAGTTAAAAAGAATCAACGAACTTAACAAT
AAACTGAGGAAAGAACTCAGCCGTGAAAGAATTACTGCTTCAAATGCATGTCTTACAATA
ATAAACTATACCTCGAATACAAAAGATTATACATTACCAGAACTATGGGGCTACCCCGTA
GCAGGATCAAATCATTTTATAGAGGGTTTGAAAAATGCTCAAAAAAATAGCCAAATGTCA
AACTCAAATAGTGTTTGTTGTACGCTTATGTAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | Not Available |
|---|
| Protein Residues | 110 |
|---|
| Protein Molecular Weight | 12625.325 |
|---|
| Protein Theoretical pI | Not Available |
|---|
| PDB File | show |
|---|
| Signalling Regions | Not Available |
|---|
| Transmembrane Regions | Not Available |
|---|
| Protein Sequence | >Guanine nucleotide-binding protein subunit gamma
MTSVQNSPRLQQPQEQQQQQQQLSLKIKQLKLKRINELNNKLRKELSRERITASNACLTI
INYTSNTKDYTLPELWGYPVAGSNHFIEGLKNAQKNSQMSNSNSVCCTLM |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | Not Available |
|---|