You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUracil phosphoribosyltransferase
Synonyms
  • UPRTase
  • UMP pyrophosphorylase
Gene NameFUR1
Enzyme Class
Biological Properties
General FunctionNucleotide transport and metabolism
Specific FunctionCatalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate
Cellular LocationNot Available
SMPDB Pathways
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG Reactions
Uracil + Phosphoribosyl pyrophosphatePyrophosphate + Uridine 5'-monophosphate
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00098UracilShow
YMDB00219PyrophosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 8
LocusYHR128W
Gene Sequence>YHR128W Chr 8 ATGTCTTCGGAACCATTTAAGAACGTCTACTTGCTACCTCAAACAAACCAATTGCTGGGT TTGTACACCATCATCAGAAATAAGAATACAACTAGACCTGATTTCATTTTCTACTCCGAT AGAATCATCAGATTGTTGGTTGAAGAAGGTTTGAACCATCTACCTGTGCAAAAGCAAATT GTGGAAACTGACACCAACGAAAACTTCGAAGGTGTCTCATTCATGGGTAAAATCTGTGGT GTTTCCATTGTCAGAGCTGGTGAATCGATGGAGCAAGGATTAAGAGACTGTTGTAGGTCT GTGCGTATCGGTAAAATTTTAATTCAAAGGGACGAGGAGACTGCTTTACCAAAGTTATTC TACGAAAAATTACCAGAGGATATATCTGAAAGGTATGTCTTCCTATTAGACCCAATGCTG GCCACCGGTGGTAGTGCTATCATGGCTACAGAAGTCTTGATTAAGAGAGGTGTTAAGCCA GAGAGAATTTACTTCTTAAACCTAATCTGTAGTAAGGAAGGGATTGAAAAATACCATGCC GCCTTCCCAGAGGTCAGAATTGTTACTGGTGCCCTCGACAGAGGTCTAGATGAAAACAAG TATCTAGTTCCAGGGTTGGGTGACTTTGGTGACAGATACTACTGTGTTTAA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues216
Protein Molecular Weight24594.19922
Protein Theoretical pI5.44
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uracil phosphoribosyltransferase MSSEPFKNVYLLPQTNQLLGLYTIIRNKNTTRPDFIFYSDRIIRLLVEEGLNHLPVQKQI VETDTNENFEGVSFMGKICGVSIVRAGESMEQGLRDCCRSVRIGKILIQRDEETALPKLF YEKLPEDISERYVFLLDPMLATGGSAIMATEVLIKRGVKPERIYFLNLICSKEGIEKYHA AFPEVRIVTGALDRGLDENKYLVPGLGDFGDRYYCV
References
External Links
ResourceLink
Saccharomyces Genome Database FUR1
Uniprot IDP18562
Uniprot NameUPP_YEAST
General Reference
  • Kern, L., de Montigny, J., Jund, R., Lacroute, F. (1990). "The FUR1 gene of Saccharomyces cerevisiae: cloning, structure and expression of wild-type and mutant alleles." Gene 88:149-157.2189783
  • Kern, L., de Montigny, J., Lacroute, F., Jund, R. (1991). "Regulation of the pyrimidine salvage pathway by the FUR1 gene product of Saccharomyces cerevisiae." Curr Genet 19:333-337.1913872
  • Clark, S. W., Meyer, D. I. (1994). "ACT3: a putative centractin homologue in S. cerevisiae is required for proper orientation of the mitotic spindle." J Cell Biol 127:129-138.7929558
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358