You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoadenosine phosphosulfate reductase
Synonyms
  • 3'-phosphoadenylylsulfate reductase
  • PAPS reductase, thioredoxin dependent
  • PAdoPS reductase
Gene NameMET16
Enzyme Class
Biological Properties
General FunctionInvolved in phosphoadenylyl-sulfate reductase (thioredoxin) activity
Specific FunctionThe NADP dependent reduction of PAPS into sulfite involves thioredoxin which probably plays the role of a thiol carrier
Cellular LocationNot Available
SMPDB Pathways
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Phosphoadenosine phosphosulfate + reduced thioredoxin → Sulfite + oxidized thioredoxin + hydron + Adenosine 3',5'-diphosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00114SulfiteShow
YMDB00120Phosphoadenosine phosphosulfateShow
YMDB00349Adenosine 3',5'-diphosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
oxidoreductase activity, acting on a sulfur group of donors
phosphoadenylyl-sulfate reductase (thioredoxin) activity
oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
catalytic activity
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
oxidation reduction
sulfur metabolic process
sulfate assimilation
sulfur amino acid metabolic process
sulfur amino acid biosynthetic process
cysteine biosynthetic process
sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR167C
Gene Sequence>786 bp ATGAAGACCTATCATTTGAATAATGATATAATTGTCACACAAGAACAGTTGGATCATTGG AATGAACAACTAATCAAGCTGGAAACGCCACAGGAGATTATTGCATGGTCTATCGTAACG TTTCCTCACCTTTTCCAAACCACTGCATTTGGTTTGACTGGCTTGGTTACTATCGATATG TTGTCAAAGCTATCTGAAAAATACTACATGCCAGAACTATTATTTATAGACACTTTGCAC CATTTCCCACAAACTTTAACACTAAAAAACGAGATTGAGAAAAAATACTACCAGCCTAAA AATCAAACCATTCACGTATATAAGCCGGATGGATGTGAATCGGAGGCAGATTTTGCCTCG AAATACGGGGATTTCTTATGGGAGAAAGATGATGACAAGTACGATTATCTGGCCAAAGTG GAACCTGCACATCGTGCCTACAAAGAGCTACATATAAGTGCTGTGTTTACTGGTAGAAGA AAATCACAAGGTTCTGCCCGCTCCCAACTGTCGATTATTGAAATAGACGAACTTAATGGA ATCTTAAAAATAAATCCATTGATCAATTGGACGTTCGAGCAGGTTAAACAGTATATAGAT GCAAACAATGTACCATACAACGAACTTTTGGACCTTGGATATAGATCCATTGGTGATTAC CATTCCACACAACCCGTCAAGGAAGGTGAAGATGAGAGAGCAGGAAGATGGAAGGGCAAG GCCAAGACCGAGTGTGGAATTCATGAAGCCAGCCGATTCGCGCAATTTTTAAAGCAAGAT GCCTAG
Protein Properties
Pfam Domain Function
Protein Residues261
Protein Molecular Weight30380.09961
Protein Theoretical pI5.8
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoadenosine phosphosulfate reductase MKTYHLNNDIIVTQEQLDHWNEQLIKLETPQEIIAWSIVTFPHLFQTTAFGLTGLVTIDM LSKLSEKYYMPELLFIDTLHHFPQTLTLKNEIEKKYYQPKNQTIHVYKPDGCESEADFAS KYGDFLWEKDDDKYDYLAKVEPAHRAYKELHISAVFTGRRKSQGSARSQLSIIEIDELNG ILKINPLINWTFEQVKQYIDANNVPYNELLDLGYRSIGDYHSTQPVKEGEDERAGRWKGK AKTECGIHEASRFAQFLKQDA
References
External Links
ResourceLink
Saccharomyces Genome Database MET16
Uniprot IDP18408
Uniprot NameMET16_YEAST
GenBank Gene IDAY693236
Genebank Protein ID51013923
General Reference
  • Thomas, D., Barbey, R., Surdin-Kerjan, Y. (1990). "Gene-enzyme relationship in the sulfate assimilation pathway of Saccharomyces cerevisiae. Study of the 3'-phosphoadenylylsulfate reductase structural gene." J Biol Chem 265:15518-15524.2203779
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106