Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameADP,ATP carrier protein 2
Synonyms
  • ADP/ATP translocase 2
  • Adenine nucleotide translocator 2
  • ANT 2
Gene NameAAC2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transporter activity
Specific FunctionCatalyzes the exchange of ADP and ATP across the mitochondrial inner membrane
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome LocationNot Available
LocusYBL030C
Gene Sequence>957 bp ATGTCTTCTAACGCCCAAGTCAAAACCCCACTACCTCCAGCCCCAGCTCCAAAGAAGGAA TCTAACTTTTTGATTGATTTCTTAATGGGTGGTGTCAGTGCCGCTGTCGCCAAAACTGCT GCATCTCCCATCGAAAGAGTTAAGCTTTTGATCCAAAACCAAGATGAAATGTTAAAACAA GGTACTTTGGACAGAAAATACGCAGGTATCTTAGACTGTTTCAAGAGAACCGCTACACAG GAAGGTGTTATCTCATTCTGGAGAGGTAACACTGCTAACGTTATCCGTTATTTCCCCACT CAAGCTTTGAATTTCGCCTTCAAGGACAAGATCAAGGCCATGTTTGGTTTCAAGAAGGAA GAAGGTTACGCCAAATGGTTTGCCGGTAACTTGGCATCTGGTGGTGCTGCTGGTGCCTTG TCATTACTATTTGTTTACTCTTTGGATTATGCAAGAACTAGATTGGCTGCTGACTCCAAG TCCTCTAAAAAGGGTGGTGCTCGTCAATTCAACGGTTTGATCGATGTCTACAAGAAGACC TTAAAATCTGATGGTGTTGCTGGTCTTTACAGAGGTTTCTTACCTTCTGTCGTTGGTATT GTTGTCTACAGAGGTCTATACTTCGGTATGTACGATTCTTTGAAGCCTCTATTGTTGACT GGTTCTTTGGAAGGTTCATTCTTGGCTTCATTCTTGTTGGGTTGGGTTGTTACTACTGGT GCTTCTACATGTTCTTACCCATTGGATACCGTTAGAAGAAGAATGATGATGACCTCCGGT CAAGCTGTTAAGTACGACGGTGCCTTTGACTGTTTGAGGAAGATTGTTGCTGCTGAAGGT GTTGGTTCTCTATTCAAGGGTTGTGGTGCTAACATCCTAAGAGGTGTCGCAGGTGCTGGT GTTATCTCAATGTACGACCAACTGCAAATGATCTTGTTTGGTAAGAAGTTCAAATAA
Protein Properties
Pfam Domain Function
Protein Residues318
Protein Molecular Weight34425.89844
Protein Theoretical pI10.33
Signalling Regions
  • None
Transmembrane Regions
  • 20-54
  • 91-115
  • 123-157
  • 192-219
  • 224-258
  • 287-312
Protein Sequence>ADP,ATP carrier protein 2 MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQ GTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE EGYAKWFAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKT LKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTG ASTCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG VISMYDQLQMILFGKKFK
References
External Links
ResourceLink
Saccharomyces Genome Database AAC2
Uniprot IDP18239
Uniprot NameADT2_YEAST
GenBank Gene IDJ04021
Genebank Protein ID170958
General Reference
  • Lawson, J. E., Douglas, M. G. (1988). "Separate genes encode functionally equivalent ADP/ATP carrier proteins in Saccharomyces cerevisiae. Isolation and analysis of AAC2." J Biol Chem 263:14812-14818.2844786
  • Kolarov, J., Kolarova, N., Nelson, N. (1990). "A third ADP/ATP translocator gene in yeast." J Biol Chem 265:12711-12716.2165073
  • Van Dyck, L., Jonniaux, J. L., de Melo Barreiros, T., Kleine, K., Goffeau, A. (1994). "Analysis of a 17.4 kb DNA segment of yeast chromosome II encompassing the ribosomal protein L19 as well as proteins with homologies to components of the hnRNP and snRNP complexes and to the human proliferation-associated p120 antigen." Yeast 10:1663-1673.7725803
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Nelson, D. R., Lawson, J. E., Klingenberg, M., Douglas, M. G. (1993). "Site-directed mutagenesis of the yeast mitochondrial ADP/ATP translocator. Six arginines and one lysine are essential." J Mol Biol 230:1159-1170.8487299
  • Nelson, D. R., Douglas, M. G. (1993). "Function-based mapping of the yeast mitochondrial ADP/ATP translocator by selection for second site revertants." J Mol Biol 230:1171-1182.7683726
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666