Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameADP,ATP carrier protein 3
Synonyms
  • ADP/ATP translocase 3
  • Adenine nucleotide translocator 3
  • ANT 3
Gene NameAAC3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transporter activity
Specific FunctionCatalyzes the exchange of ADP and ATP across the mitochondrial inner membrane
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
organelle membrane
organelle inner membrane
mitochondrial inner membrane
Function
binding
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 2
LocusYBR085W
Gene Sequence>924 bp ATGAGTAGCGACGCTAAGCAACAAGAAACAAACTTTGCCATTAATTTCTTAATGGGTGGT GTGAGTGCGGCCATCGCTAAAACTGCTGCCTCACCAATCGAAAGAGTCAAGATCTTGATC CAAAATCAAGATGAAATGATCAAGCAAGGAACTTTAGATAAAAAGTATTCCGGTATCGTG GATTGTTTCAAGAGAACTGCAAAGCAAGAGGGACTAATATCCTTTTGGCGAGGAAATACT GCCAATGTTATTCGTTATTTTCCCACTCAAGCTTTGAACTTCGCCTTCAAAGATAAGATT AAGTTGATGTTTGGTTTCAAGAAAGAGGAAGGCTATGGTAAATGGTTTGCAGGTAATCTG GCTTCTGGTGGTGCAGCTGGTGCTCTTTCGTTATTATTTGTTTATTCTTTAGATTTTGCC AGAACCAGACTTGCTGCTGATGCAAAATCGTCGAAAAAGGGTGGCGCTCGCCAATTCAAT GGGTTGACTGATGTTTATAAAAAGACCTTGAAATCGGATGGTATCGCAGGATTATACAGA GGATTCATGCCATCAGTAGTGGGTATCGTGGTTTATAGAGGACTATATTTCGGTATGTTT GATTCTCTCAAGCCACTGGTGCTAACTGGTTCATTAGATGGTTCATTCTTGGCTTCATTT TTATTGGGATGGGTGGTCACTACAGGTGCCTCAACATGTTCTTATCCATTAGACACAGTG AGAAGAAGAATGATGATGACTTCAGGTCAAGCAGTAAAGTACAACGGTGCTATAGATTGT CTCAAAAAAATCGTAGCTTCTGAAGGTGTAGGGTCATTGTTCAAAGGCTGCGGGGCAAAT ATCTTGAGAAGTGTTGCTGGAGCTGGTGTTATTTCCATGTATGACCAGTTGCAAATGATA TTGTTCGGTAAAAAATTCAAATGA
Protein Properties
Pfam Domain Function
Protein Residues307
Protein Molecular Weight33312.60156
Protein Theoretical pI10.38
Signalling Regions
  • None
Transmembrane Regions
  • 9-43
  • 80-104
  • 112-146
  • 181-208
  • 213-247
  • 276-301
Protein Sequence>ADP,ATP carrier protein 3 MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIV DCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAGNL ASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYR GFMPSVVGIVVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTV RRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMI LFGKKFK
References
External Links
ResourceLink
Saccharomyces Genome Database AAC3
Uniprot IDP18238
Uniprot NameADT3_YEAST
GenBank Gene IDM34076
Genebank Protein ID170960
General Reference
  • Kolarov, J., Kolarova, N., Nelson, N. (1990). "A third ADP/ATP translocator gene in yeast." J Biol Chem 265:12711-12716.2165073
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106