Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCholinephosphotransferase 1
Synonyms
  • Diacylglycerol cholinephosphotransferase 1
  • Sn-1,2-diacylglycerol cholinephosphotransferase
  • CHOPT
Gene NameCPT1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, for other substituted phosphate groups
Specific FunctionInvolved in protein-dependent process of phospholipid transport to distribute phosphatidyl choline to the lumenal surface. The multiple transmembrane domains and lumenal hydrophilic domains of the cholinephosphotransferase might participate in the transport process
Cellular LocationMicrosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
Choline metabolismPW002494 ThumbThumb?image type=greyscaleThumb?image type=simple
Ether lipid metabolismPW002492 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Ether lipid metabolismec00565 Map00565
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Citicoline + 1-O-Hexadecyl-2-O-acetyl-sn-glycerolCytidine monophosphate + 2-O-acetyl-1-O-hexadecyl-sn-glycero-3-phosphocholine
1-O-Hexadecyl-2-palmitoyl-sn-glycerol + Citicoline1-O-Palmityl-2-palmitoyl-rac-glycero-3-phosphocholine + Cytidine monophosphate
Citicoline + DG(16:0/16:0/0:0)PC(16:0/16:0) + Cytidine monophosphate + hydron
Citicoline + DG(14:0/14:0/0:0)Cytidine monophosphate + hydron + PC(14:0/14:0)
Citicoline + DG(10:0/10:0/0:0) → Cytidine monophosphate + hydron + PC(10:0/10:0)
KEGG Reactions
Citicoline + 1,2-dioleoylglycerolPC(18:1(9Z)/18:1(9Z)) + Cytidine monophosphate
Citicoline + DG(16:0/16:0/0:0) → phosphatidylcholine + Cytidine monophosphate
Metabolites
YMDB IDNameView
YMDB00090CiticolineShow
YMDB00324PrephenateShow
YMDB00406Cytidine monophosphateShow
YMDB006271,2-dioleoylglycerolShow
YMDB00862hydronShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01180PC(16:0/16:0)Show
YMDB01185PC(16:1(9Z)/16:1(9Z))Show
YMDB01188PC(18:0/18:0)Show
YMDB01191PC(18:1(9Z)/18:1(9Z))Show
YMDB12737DG(14:0/14:0/0:0)Show
YMDB13563PC(10:0/10:0)Show
YMDB13570PC(14:0/14:0)Show
YMDB13626PC(16:1(11Z)/16:1(11Z))Show
YMDB15897PC(18:2(9Z,11Z)/18:2(9Z,11Z))Show
YMDB15898PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))Show
YMDB16194DG(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z)/0:0)Show
YMDB163271-O-Hexadecyl-2-O-acetyl-sn-glycerolShow
YMDB163282-O-acetyl-1-O-hexadecyl-sn-glycero-3-phosphocholineShow
YMDB163301-O-Palmityl-2-palmitoyl-rac-glycero-3-phosphocholineShow
YMDB163311-O-Hexadecyl-2-palmitoyl-sn-glycerolShow
GO Classification
Component
cell part
membrane
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
Process
metabolic process
organophosphate metabolic process
phospholipid metabolic process
phospholipid biosynthetic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL130C
Gene Sequence>1224 bp ATGGATTCGAAAACAGTATTACTAACTGATTCAGGGGAAACAATGGGATTCTTTATTCCT CAGAGTAGTTTGGGAAACTTGAAGCTTTACAAGTATCAAAGTGATGACCGCTCTTTCCTT TCAAACCATGTATTGAGGCCCTTTTGGAGAAAGTTTGCGACTATTTTTCCACTATGGATG GCACCCAATTTGGTAACATTATTAGGGTTCTGCTTTATTATATTTAATGTGTTAACAACA CTTTACTACGACCCGTATTTTGACCAGGAATCGCCACGTTGGACCTATTTCTCCTATGCT ATAGGTTTGTTTTTATACCAGACTTTTGATGCTTGCGATGGAATGCATGCACGTCGTACA GGCCAGCAGGGCCCTCTAGGGGAATTGTTTGACCATTGTATTGATTCAATCAACACAACT TTGTCAATGATTCCTGTCTGTTCCATGACAGGTATGGGTTACACATATATGACCATTTTT TCACAATTTGCGATATTGTGCAGCTTTTACTTGAGCACATGGGAAGAGTATCACACCCAC AAACTTTATCTAGCTGAATTCTGCGGTCCTGTTGAAGGTATTATTGTTTTGTGTATTTCT TTCATTGCAGTCGGAATTTACGGACCTCAAACCATCTGGCACACTAAAGTAGCGCAATTC TCCTGGCAAGATTTTGTGTTTGATGTTGAAACCGTTCATCTAATGTATGCATTTTGCACA GGAGCATTAATATTTAATATTGTCACAGCTCATACAAACGTCGTGAGGTATTACGAATCC CAATCGACCAAATCTGCAACTCCAAGCAAAACTGCAGAAAATATAAGTAAAGCAGTAAAT GGTCTTTTGCCATTCTTTGCATACTTCTCTTCAATTTTTACCTTAGTCTTGATTCAACCA TCTTTTATTTCTTTGGCTTTAATTTTATCGATTGGTTTTTCGGTTGCCTTTGTAGTTGGT CGGATGATTATTGCTCATTTAACCATGCAACCATTCCCAATGGTCAATTTCCCATTTTTA ATCCCAACTATCCAATTGGTATTGTACGCATTTATGGTTTACGTTTTAGATTACCAAAAA GGAAGCATAGTTTCTGCATTGGTTTGGATGGGACTCGGCTTGACACTTGCTATCCATGGA ATGTTCATCAATGATATTATCTATGACATCACTACCTTTCTGGATATTTACGCTTTATCA ATTAAACATCCAAAAGAAATTTAG
Protein Properties
Pfam Domain Function
Protein Residues393
Protein Molecular Weight44829.0
Protein Theoretical pI6.57
Signalling Regions
  • None
Transmembrane Regions
  • 41-61
  • 173-193
  • 211-231
  • 264-284
  • 286-306
  • 321-341
  • 349-369
Protein Sequence>Cholinephosphotransferase 1 MGFFIPQSSLGNLKLYKYQSDDRSFLSNHVLRPFWRKFATIFPLWMAPNLVTLLGFCFII FNVLTTLYYDPYFDQESPRWTYFSYAIGLFLYQTFDACDGMHARRTGQQGPLGELFDHCI DSINTTLSMIPVCSMTGMGYTYMTIFSQFAILCSFYLSTWEEYHTHKLYLAEFCGPVEGI IVLCISFIAVGIYGPQTIWHTKVAQFSWQDFVFDVETVHLMYAFCTGALIFNIVTAHTNV VRYYESQSTKSATPSKTAENISKAVNGLLPFFAYFSSIFTLVLIQPSFISLALILSIGFS VAFVVGRMIIAHLTMQPFPMVNFPFLIPTIQLVLYAFMVYVLDYQKGSIVSALVWMGLGL TLAIHGMFINDIIYDITTFLDIYALSIKHPKEI
References
External Links
ResourceLink
Saccharomyces Genome Database CPT1
Uniprot IDP17898
Uniprot NameCPT1_YEAST
GenBank Gene IDJ05203
Genebank Protein ID171318
General Reference
  • Hjelmstad, R. H., Bell, R. M. (1990). "The sn-1,2-diacylglycerol cholinephosphotransferase of Saccharomyces cerevisiae. Nucleotide sequence, transcriptional mapping, and gene product analysis of the CPT1 gene." J Biol Chem 265:1755-1764.2153142
  • Mallet, L., Bussereau, F., Jacquet, M. (1995). "A 43.5 kb segment of yeast chromosome XIV, which contains MFA2, MEP2, CAP/SRV2, NAM9, FKB1/FPR1/RBP1, MOM22 and CPT1, predicts an adenosine deaminase gene and 14 new open reading frames." Yeast 11:1195-1209.8619318
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hjelmstad, R. H., Bell, R. M. (1991). "sn-1,2-diacylglycerol choline- and ethanolaminephosphotransferases in Saccharomyces cerevisiae. Mixed micellar analysis of the CPT1 and EPT1 gene products." J Biol Chem 266:4357-4365.1847919
  • Brachat, S., Dietrich, F. S., Voegeli, S., Zhang, Z., Stuart, L., Lerch, A., Gates, K., Gaffney, T., Philippsen, P. (2003). "Reinvestigation of the Saccharomyces cerevisiae genome annotation by comparison to the genome of a related fungus: Ashbya gossypii." Genome Biol 4:R45.12844361
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106