You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMalate dehydrogenase, mitochondrial
SynonymsNot Available
Gene NameMDH1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific Function(S)-malate + NAD(+) = oxaloacetate + NADH
Cellular LocationMitochondrion matrix
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glyoxylate and dicarboxylate metabolismec00630 Map00630
Methane metabolismec00680 Map00680
Pyruvate metabolismec00620 Map00620
SMPDB ReactionsNot Available
KEGG Reactions
NAD + (S)-malate(2-)NADH + hydron + Oxalacetic acid
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00235Oxalacetic acidShow
YMDB00280(S)-Malic acidShow
YMDB00412NAD(+)Show
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
malate dehydrogenase activity
oxidoreductase activity
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
catalytic activity
binding
L-malate dehydrogenase activity
Process
carbohydrate metabolic process
malate metabolic process
oxidation reduction
organic acid metabolic process
metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
cellular metabolic process
cellular carbohydrate metabolic process
dicarboxylic acid metabolic process
primary metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1005 bp ATGTTGTCAAGAGTAGCTAAACGTGCGTTTTCCTCTACAGTTGCCAACCCTTATAAAGTG ACTGTTTTGGGTGCAGGCGGTGGTATTGGACAACCATTGTCTTTGCTTCTAAAGCTTAAC CATAAAGTCACGGACTTAAGACTGTACGACCTAAAGGGCGCAAAAGGTGTTGCCACCGAT TTGTCTCATATTCCAACAAACTCCGTGGTCAAGGGGTTTACTCCAGAAGAGCCAGACGGA TTGAACAACGCTTTAAAGGACACAGACATGGTTTTAATTCCTGCTGGTGTGCCCAGAAAG CCTGGTATGACACGTGATGACTTGTTCGCCATCAACGCAAGCATCGTTCGCGATTTGGCA GCAGCAACCGCCGAATCCGCTCCCAATGCTGCCATTCTGGTCATTTCCAACCCAGTCAAT TCTACCGTTCCAATTGTCGCCCAAGTCTTGAAAAACAAGGGTGTTTACAACCCAAAGAAA TTGTTCGGTGTGACTACCTTGGACTCTATTAGAGCCGCCAGATTCATCTCAGAAGTCGAG AACACCGATCCAACTCAGGAAAGGGTTAACGTCATCGGTGGACATTCTGGTATTACCATC ATCCCATTGATTTCGCAAACAAACCATAAGTTGATGTCTGATGACAAGAGACACGAATTG ATTCACAGAATACAGTTTGGTGGTGACGAAGTCGTCAAAGCAAAGAATGGTGCTGGCTCT GCTACGTTGTCAATGGCCCATGCTGGTGCTAAATTCGCTAACGCTGTTTTGTCCGGTTTC AAAGGCGAAAGAGACGTCATCGAGCCTTCCTTCGTGGACTCTCCCTTGTTCAAATCCGAA GGCATCGAATTCTTTGCATCTCCGGTCACTTTGGGCCCAGATGGTATTGAAAAGATCCAT CCAATAGGTGAGTTATCTTCAGAAGAAGAAGAAATGCTACAAAAATGTAAAGAAACCTTG AAGAAGAATATCGAAAAGGGTGTCAACTTTGTTGCTAGTAAATAG
Protein Properties
Pfam Domain Function
Protein Residues334
Protein Molecular Weight35649.60156
Protein Theoretical pI8.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Malate dehydrogenase, mitochondrial MLSRVAKRAFSSTVANPYKVTVLGAGGGIGQPLSLLLKLNHKVTDLRLYDLKGAKGVATD LSHIPTNSVVKGFTPEEPDGLNNALKDTDMVLIPAGVPRKPGMTRDDLFAINASIVRDLA AATAESAPNAAILVISNPVNSTVPIVAQVLKNKGVYNPKKLFGVTTLDSIRAARFISEVE NTDPTQERVNVIGGHSGITIIPLISQTNHKLMSDDKRHELIHRIQFGGDEVVKAKNGAGS ATLSMAHAGAKFANAVLSGFKGERDVIEPSFVDSPLFKSEGIEFFASPVTLGPDGIEKIH PIGELSSEEEEMLQKCKETLKKNIEKGVNFVASK
References
External Links
ResourceLink
Saccharomyces Genome Database MDH1
Uniprot IDP17505
Uniprot NameMDHM_YEAST
GenBank Gene IDJ02841
Genebank Protein ID171892
General Reference
  • Thompson, L. M., Sutherland, P., Steffan, J. S., McAlister-Henn, L. (1988). "Gene sequence and primary structure of mitochondrial malate dehydrogenase from Saccharomyces cerevisiae." Biochemistry 27:8393-8400.3072021
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Kopetzki, E., Entian, K. D., Lottspeich, F., Mecke, D. (1987). "Purification procedure and N-terminal amino acid sequence of yeast malate dehydrogenase isoenzymes." Biochim Biophys Acta 912:398-403.3552052
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666