You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomoserine kinase
Synonyms
  • HK
  • HSK
Gene NameTHR1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionCatalyzes the ATP-dependent phosphorylation of L- homoserine to L-homoserine phosphate
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Homoserinehydron + O-Phosphohomoserine + ADP
Metabolites
YMDB IDNameView
YMDB00104L-HomoserineShow
YMDB00109Adenosine triphosphateShow
YMDB00258O-PhosphohomoserineShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
homoserine kinase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
phosphotransferase activity, alcohol group as acceptor
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
threonine metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
phosphorus metabolic process
phosphate metabolic process
phosphorylation
metabolic process
aspartate family amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR025W
Gene Sequence>1074 bp ATGGTTCGTGCCTTCAAAATTAAAGTTCCAGCTTCTTCCGCCAATATCGGCCCTGGTTAT GATGTTCTTGGTGTCGGTCTTTCTCTATTCTTGGAGTTAGATGTCACCATCGACTCCAGC CAAGCTCAGGAAACAAACGACGATCCCAACAACTGCAAGCTGTCTTACACTAAAGAAAGT GAAGGCTATTCTACGGTCCCATTGCGTTCTGATGCTAACCTGATTACCAGGACTGCGTTA TATGTGTTGCGTTGCAACAATATTAGAAACTTCCCCTCCGGAACCAAAGTTCACGTCTCC AACCCAATCCCACTTGGCCGTGGATTGGGTTCCTCTGGTGCAGCAGTTGTGGCAGGTGTT ATTTTAGGTAACGAAGTGGCCCAATTGGGTTTCTCTAAGCAACGTATGTTGGACTACTGT TTGATGATTGAACGTCATCCAGACAACATAACCGCTGCTATGATGGGAGGCTTTTGCGGT TCATTCCTAAGGGACTTGACCCCACAAGAGGTGGAAAGACGTGAGATTCCATTGGCTGAG GTGCTTCCAGAACCTTCTGGTGGTGAAGATACCGGTCTGGTTCCCCCATTACCTCCCACC GATATCGGTAGACATGTCAAATACCAATGGAACCCCGCCATTAAATGTATTGCGATCATC CCACAGTTCGAGTTGTCCACCGCCGACTCCAGAGGCGTTCTTCCAAAAGCCTACCCAACC CAGGACTTGGTTTTCAATCTACAAAGATTGGCCGTCTTGACCACAGCTTTGACCATGGAC CCACCTAATGCCGACTTAATCTACCCTGCTATGCAAGATCGTGTCCACCAACCTTATAGA AAGACATTGATCCCAGGTCTCACGGAAATCTTATCATGTGTCACCCCATCCACATACCCT GGCCTATTGGGTATCTGCTTGTCAGGTGCAGGCCCAACTATCTTGGCTTTGGCCACTGAG AATTTCGAAGAAATCTCTCAAGAAATTATCAACAGGTTCGCCAAAAACGGCATCAAGTGC TCCTGGAAACTACTGGAGCCTGCCTACGATGGTGCTAGCGTCGAACAGCAATGA
Protein Properties
Pfam Domain Function
Protein Residues357
Protein Molecular Weight38712.0
Protein Theoretical pI5.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homoserine kinase MVRAFKIKVPASSANIGPGYDVLGVGLSLFLELDVTIDSSQAQETNDDPNNCKLSYTKES EGYSTVPLRSDANLITRTALYVLRCNNIRNFPSGTKVHVSNPIPLGRGLGSSGAAVVAGV ILGNEVAQLGFSKQRMLDYCLMIERHPDNITAAMMGGFCGSFLRDLTPQEVERREIPLAE VLPEPSGGEDTGLVPPLPPTDIGRHVKYQWNPAIKCIAIIPQFELSTADSRGVLPKAYPT QDLVFNLQRLAVLTTALTMDPPNADLIYPAMQDRVHQPYRKTLIPGLTEILSCVTPSTYP GLLGICLSGAGPTILALATENFEEISQEIINRFAKNGIKCSWKLLEPAYDGASVEQQ
References
External Links
ResourceLink
Saccharomyces Genome Database THR1
Uniprot IDP17423
Uniprot NameKHSE_YEAST
GenBank Gene IDM37692
Genebank Protein ID172978
General Reference
  • Mannhaupt, G., Pohlenz, H. D., Seefluth, A. K., Pilz, U., Feldmann, H. (1990). "Yeast homoserine kinase. Characteristics of the corresponding gene, THR1, and the purified enzyme, and evolutionary relationships with other enzymes of threonine metabolism." Eur J Biochem 191:115-122.2165904
  • Schultes, N. P., Ellington, A. D., Cherry, J. M., Szostak, J. W. (1990). "Saccharomyces cerevisiae homoserine kinase is homologous to prokaryotic homoserine kinases." Gene 96:177-180.2176637
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956