You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameV-type proton ATPase catalytic subunit A
Synonyms
  • V-ATPase subunit A
  • Vacuolar proton pump subunit A
  • Endonuclease PI-SceI
  • Sce VMA intein
  • VMA1-derived endonuclease
  • VDE
Gene NameTFP1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionPI-SceI is an endonuclease that can cleave at a site present in a VMA1 allele that lacks the derived endonuclease segment of the open reading frame; cleavage at this site only occurs during meiosis and initiates "homing", a genetic event that converts a VMA1 allele lacking VDE into one that contains it
Cellular LocationEndomembrane system. Vacuole membrane (Probable).
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Methane metabolismec00680 Map00680
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
macromolecular complex
protein complex
proton-transporting two-sector ATPase complex, catalytic domain
proton-transporting two-sector ATPase complex
Function
proton-transporting ATPase activity, rotational mechanism
transporter activity
monovalent inorganic cation transmembrane transporter activity
transmembrane transporter activity
hydrogen ion transmembrane transporter activity
hydrogen ion transporting ATP synthase activity, rotational mechanism
hydrolase activity
nucleic acid binding
catalytic activity
binding
substrate-specific transmembrane transporter activity
nuclease activity
nucleoside binding
ion transmembrane transporter activity
DNA binding
purine nucleoside binding
hydrolase activity, acting on ester bonds
cation transmembrane transporter activity
adenyl nucleotide binding
hydrolase activity, acting on acid anhydrides
inorganic cation transmembrane transporter activity
adenyl ribonucleotide binding
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
endonuclease activity
ATP binding
Process
nucleobase, nucleoside and nucleotide metabolic process
purine ribonucleoside triphosphate metabolic process
purine ribonucleoside triphosphate biosynthetic process
nucleoside phosphate metabolic process
ATP metabolic process
ATP biosynthetic process
nucleotide metabolic process
establishment of localization
hydrogen transport
purine nucleotide metabolic process
transport
proton transport
intein-mediated protein splicing
purine nucleotide biosynthetic process
protein metabolic process
metabolic process
protein maturation
macromolecule metabolic process
protein processing
nitrogen compound metabolic process
protein splicing
cellular nitrogen compound metabolic process
ATP synthesis coupled proton transport
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
purine nucleoside triphosphate metabolic process
purine nucleoside triphosphate biosynthetic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>3216 bp ATGGCTGGTGCAATTGAAAACGCTCGTAAGGAAATAAAAAGAATCTCATTAGAAGACCAT GCTGAATCTGAATATGGTGCCATCTATTCTGTCTCTGGTCCGGTCGTCATTGCTGAAAAT ATGATTGGTTGTGCCATGTACGAATTGGTCAAGGTCGGTCACGATAACCTGGTGGGTGAA GTCATTAGAATTGACGGTGACAAGGCCACCATCCAAGTTTACGAAGAAACTGCAGGCCTT ACGGTCGGTGACCCTGTTTTGAGAACAGGTAAGCCTCTGTCGGTAGAATTGGGTCCTGGT CTGATGGAAACCATTTACGATGGTATTCAAAGACCTTTGAAAGCCATTAAGGAAGAATCG CAATCGATTTATATCCCAAGAGGTATTGACACTCCAGCTTTGGATAGGACTATCAAGTGG CAATTTACTCCGGGAAAGTTTCAAGTCGGCGATCATATTTCCGGTGGTGATATTTACGGT TCCGTTTTTGAGAATTCGCTAATTTCAAGCCATAAGATTCTTTTGCCACCAAGATCAAGA GGTACAATCACTTGGATTGCTCCAGCTGGTGAGTACACTTTGGATGAGAAGATTTTGGAA GTTGAATTTGATGGCAAGAAGTCTGATTTCACTCTTTACCATACTTGGCCTGTTCGTGTT CCAAGACCAGTTACTGAAAAGTTATCTGCTGACTATCCTTTGTTAACAGGTCAAAGAGTT TTGGATGCTTTGTTTCCTTGTGTTCAAGGTGGTACGACATGTATTCCAGGTGCTTTTGGT TGTGGTAAGACCGTTATCTCTCAATCTTTGTCCAAGTACTCCAATTCTGACGCCATTATC TATGTCGGGTGCTTTGCCAAGGGTACCAATGTTTTAATGGCGGATGGGTCTATTGAATGT ATTGAAAACATTGAGGTTGGTAATAAGGTCATGGGTAAAGATGGCAGACCTCGTGAGGTA ATTAAATTGCCCAGAGGAAGAGAAACTATGTACAGCGTCGTGCAGAAAAGTCAGCACAGA GCCCACAAAAGTGACTCAAGTCGTGAAGTGCCAGAATTACTCAAGTTTACGTGTAATGCG ACCCATGAGTTGGTTGTTAGAACACCTCGTAGTGTCCGCCGTTTGTCTCGTACCATTAAG GGTGTCGAATATTTTGAAGTTATTACTTTTGAGATGGGCCAAAAGAAAGCCCCCGACGGT AGAATTGTTGAGCTTGTCAAGGAAGTTTCAAAGAGCTACCCAATATCTGAGGGGCCTGAG AGAGCCAACGAATTAGTAGAATCCTATAGAAAGGCTTCAAATAAAGCTTATTTTGAGTGG ACTATTGAGGCCAGAGATCTTTCTCTGTTGGGTTCCCATGTTCGTAAAGCTACCTACCAG ACTTACGCTCCAATTCTTTATGAGAATGACCACTTTTTCGACTACATGCAAAAAAGTAAG TTTCATCTCACCATTGAAGGTCCAAAAGTACTTGCTTATTTACTTGGTTTATGGATTGGT GATGGATTGTCTGACAGGGCAACTTTTTCGGTTGATTCCAGAGATACTTCTTTGATGGAA CGTGTTACTGAATATGCTGAAAAGTTGAATTTGTGCGCCGAGTATAAGGACAGAAAAGAA CCACAAGTTGCCAAAACTGTTAATTTGTACTCTAAAGTTGTCAGAGGTAATGGTATTCGC AATAATCTTAATACTGAGAATCCATTATGGGACGCTATTGTTGGCTTAGGATTCTTGAAG GACGGTGTCAAAAATATTCCTTCTTTCTTGTCTACGGACAATATCGGTACTCGTGAAACA TTTCTTGCTGGTCTAATTGATTCTGATGGCTATGTTACTGATGAGCATGGTATTAAAGCA ACAATAAAGACAATTCATACTTCTGTCAGAGATGGTTTGGTTTCCCTTGCTCGTTCTTTA GGCTTAGTAGTCTCGGTTAACGCAGAACCTGCTAAGGTTGACATGAATGGCACCAAACAT AAAATTAGTTATGCTATTTATATGTCTGGTGGAGATGTTTTGCTTAACGTTCTTTCGAAG TGTGCCGGCTCTAAAAAATTCAGGCCTGCTCCCGCCGCTGCTTTTGCACGTGAGTGCCGC GGATTTTATTTCGAGTTACAAGAATTGAAGGAAGACGATTATTATGGGATTACTTTATCT GATGATTCTGATCATCAGTTTTTGCTTGCCAACCAGGTTGTCGTCCATAATTGCGGAGAA AGAGGTAATGAAATGGCAGAAGTCTTGATGGAATTCCCAGAGTTATATACTGAAATGAGC GGTACTAAAGAACCAATTATGAAGCGTACTACTTTGGTCGCTAATACATCTAACATGCCG GTTGCAGCCAGAGAAGCTTCTATTTACACTGGTATCACTCTTGCAGAATACTTCAGAGAT CAAGGTAAAAATGTTTCTATGATTGCAGACTCTTCTTCAAGATGGGCTGAAGCTTTGAGA GAAATTTCTGGTCGTTTGGGTGAGATGCCTGCTGATCAAGGTTTCCCAGCTTATTTGGGT GCTAAGTTGGCCTCCTTTTACGAAAGAGCCGGTAAAGCTGTTGCTTTAGGTTCCCCAGAT CGTACTGGTTCCGTTTCCATCGTTGCTGCCGTTTCGCCAGCCGGTGGTGATTTCTCAGAT CCTGTTACTACTGCTACATTGGGTATCACTCAAGTCTTTTGGGGTTTAGACAAGAAATTG GCTCAAAGAAAGCATTTCCCATCTATCAACACATCTGTTTCTTACTCCAAATACACTAAT GTCTTGAACAAGTTTTATGATTCCAATTACCCTGAATTTCCTGTTTTAAGAGATCGTATG AAGGAAATTCTATCAAACGCTGAAGAATTAGAACAAGTTGTTCAATTAGTTGGTAAATCG GCCTTGTCTGATAGTGATAAGATTACTTTGGATGTTGCCACTTTAATCAAGGAAGATTTC TTGCAACAAAATGGTTACTCCACTTATGATGCTTTCTGTCCAATTTGGAAGACATTTGAT ATGATGAGAGCCTTCATCTCGTATCATGACGAAGCTCAAAAAGCTGTTGCTAATGGTGCC AACTGGTCAAAACTAGCTGACTCTACTGGTGACGTTAAGCATGCCGTTTCTTCATCTAAA TTTTTTGAACCAAGCAGGGGTGAAAAGGAAGTCCATGGCGAATTCGAAAAATTGTTGAGC ACTATGCAAGAAAGATTTGCTGAATCTACCGATTAA
Protein Properties
Pfam Domain Function
Protein Residues1071
Protein Molecular Weight118636.0
Protein Theoretical pI6.05
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>V-type proton ATPase catalytic subunit A MAGAIENARKEIKRISLEDHAESEYGAIYSVSGPVVIAENMIGCAMYELVKVGHDNLVGE VIRIDGDKATIQVYEETAGLTVGDPVLRTGKPLSVELGPGLMETIYDGIQRPLKAIKEES QSIYIPRGIDTPALDRTIKWQFTPGKFQVGDHISGGDIYGSVFENSLISSHKILLPPRSR GTITWIAPAGEYTLDEKILEVEFDGKKSDFTLYHTWPVRVPRPVTEKLSADYPLLTGQRV LDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNSDAIIYVGCFAKGTNVLMADGSIEC IENIEVGNKVMGKDGRPREVIKLPRGRETMYSVVQKSQHRAHKSDSSREVPELLKFTCNA THELVVRTPRSVRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEGPE RANELVESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYENDHFFDYMQKSK FHLTIEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKE PQVAKTVNLYSKVVRGNGIRNNLNTENPLWDAIVGLGFLKDGVKNIPSFLSTDNIGTRET FLAGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNGTKH KISYAIYMSGGDVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKEDDYYGITLS DDSDHQFLLANQVVVHNCGERGNEMAEVLMEFPELYTEMSGTKEPIMKRTTLVANTSNMP VAAREASIYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLG AKLASFYERAGKAVALGSPDRTGSVSIVAAVSPAGGDFSDPVTTATLGITQVFWGLDKKL AQRKHFPSINTSVSYSKYTNVLNKFYDSNYPEFPVLRDRMKEILSNAEELEQVVQLVGKS ALSDSDKITLDVATLIKEDFLQQNGYSTYDAFCPIWKTFDMMRAFISYHDEAQKAVANGA NWSKLADSTGDVKHAVSSSKFFEPSRGEKEVHGEFEKLLSTMQERFAESTD
References
External Links
ResourceLink
Saccharomyces Genome Database TFP1
Uniprot IDP17255
Uniprot NameVATA_YEAST
GenBank Gene IDJ05409
Genebank Protein ID171650
PDB ID
1JVA
General Reference
  • Hirata, R., Ohsumk, Y., Nakano, A., Kawasaki, H., Suzuki, K., Anraku, Y. (1990). "Molecular structure of a gene, VMA1, encoding the catalytic subunit of H(+)-translocating adenosine triphosphatase from vacuolar membranes of Saccharomyces cerevisiae." J Biol Chem 265:6726-6733.2139027
  • Verhasselt, P., Voet, M., Volckaert, G. (1995). "New open reading frames, one of which is similar to the nifV gene of Azotobacter vinelandii, found on a 12.5 kbp fragment of chromosome IV of Saccharomyces cerevisiae." Yeast 11:961-966.8533471
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ronne, H., Carlberg, M., Hu, G. Z., Nehlin, J. O. (1991). "Protein phosphatase 2A in Saccharomyces cerevisiae: effects on cell growth and bud morphogenesis." Mol Cell Biol 11:4876-4884.1656215
  • Mizutani, R., Nogami, S., Kawasaki, M., Ohya, Y., Anraku, Y., Satow, Y. (2002). "Protein-splicing reaction via a thiazolidine intermediate: crystal structure of the VMA1-derived endonuclease bearing the N and C-terminal propeptides." J Mol Biol 316:919-929.11884132
  • Shih, C. K., Wagner, R., Feinstein, S., Kanik-Ennulat, C., Neff, N. (1988). "A dominant trifluoperazine resistance gene from Saccharomyces cerevisiae has homology with F0F1 ATP synthase and confers calcium-sensitive growth." Mol Cell Biol 8:3094-3103.2905423
  • Kane, P. M., Yamashiro, C. T., Wolczyk, D. F., Neff, N., Goebl, M., Stevens, T. H. (1990). "Protein splicing converts the yeast TFP1 gene product to the 69-kD subunit of the vacuolar H(+)-adenosine triphosphatase." Science 250:651-657.2146742
  • Hirata, R., Anraku, Y. (1992). "Mutations at the putative junction sites of the yeast VMA1 protein, the catalytic subunit of the vacuolar membrane H(+)-ATPase, inhibit its processing by protein splicing." Biochem Biophys Res Commun 188:40-47.1417861
  • Cooper, A. A., Chen, Y. J., Lindorfer, M. A., Stevens, T. H. (1993). "Protein splicing of the yeast TFP1 intervening protein sequence: a model for self-excision." EMBO J 12:2575-2583.8508780
  • Gimble, F. S., Thorner, J. (1992). "Homing of a DNA endonuclease gene by meiotic gene conversion in Saccharomyces cerevisiae." Nature 357:301-306.1534148
  • Seol, J. H., Shevchenko, A., Shevchenko, A., Deshaies, R. J. (2001). "Skp1 forms multiple protein complexes, including RAVE, a regulator of V-ATPase assembly." Nat Cell Biol 3:384-391.11283612
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Grivell, L. A. (1992). "Homing in on an endosymbiotic endonuclease." Curr Biol 2:450-452.15335920
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Duan, X., Gimble, F. S., Quiocho, F. A. (1997). "Crystal structure of PI-SceI, a homing endonuclease with protein splicing activity." Cell 89:555-564.9160747
  • Hu, D., Crist, M., Duan, X., Quiocho, F. A., Gimble, F. S. (2000). "Probing the structure of the PI-SceI-DNA complex by affinity cleavage and affinity photocross-linking." J Biol Chem 275:2705-2712.10644733
  • Poland, B. W., Xu, M. Q., Quiocho, F. A. (2000). "Structural insights into the protein splicing mechanism of PI-SceI." J Biol Chem 275:16408-16413.10828056
  • Werner, E., Wende, W., Pingoud, A., Heinemann, U. (2002). "High resolution crystal structure of domain I of the Saccharomyces cerevisiae homing endonuclease PI-SceI." Nucleic Acids Res 30:3962-3971.12235380