You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphofructokinase subunit beta
Synonyms
  • 6PF-1-K subunit beta
  • Phosphofructokinase 2
  • Phosphohexokinase
Gene NamePFK2
Enzyme Class
Biological Properties
General FunctionInvolved in 6-phosphofructokinase activity
Specific FunctionATP + D-fructose 6-phosphate = ADP + D- fructose 1,6-bisphosphate
Cellular LocationCytoplasm
SMPDB Pathways
Ethanol fermentationPW002448 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00108Fructose 1,6-bisphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00687D-fructose 1,6-bisphosphateShow
YMDB00914ADPShow
GO Classification
Component
macromolecular complex
protein complex
6-phosphofructokinase complex
cell part
intracellular part
cytoplasm
Function
phosphotransferase activity, alcohol group as acceptor
phosphofructokinase activity
catalytic activity
transferase activity
6-phosphofructokinase activity
transferase activity, transferring phosphorus-containing groups
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR205C
Gene Sequence>2880 bp ATGACTGTTACTACTCCTTTTGTGAATGGTACTTCTTATTGTACCGTCACTGCATATTCC GTTCAATCTTATAAAGCTGCCATAGATTTTTACACCAAGTTTTTGTCATTAGAAAACCGC TCTTCTCCAGATGAAAACTCCACTTTATTGTCTAACGATTCCATCTCTTTGAAGATCCTT CTACGTCCTGATGAAAAAATCAATAAAAATGTTGAGGCTCATTTGAAGGAATTGAACAGT ATTACCAAGACTCAAGACTGGAGATCACATGCCACCCAATCCTTGGTATTTAACACTTCC GACATCTTGGCAGTCAAGGACACTCTAAATGCTATGAACGCTCCTCTTCAAGGCTACCCA ACAGAACTATTTCCAATGCAGTTGTACACTTTGGACCCATTAGGTAACGGTGTTGGTGTT ACTTCTACTAAGAACGCAGTTTCAACCAAGCCAACTCCACCACCAGCACCAGAAGCTTCT GCTGAGTCTGGTCTTTCCTCTAAAGTTCACTCTTACACTGATTTGGCTTACCGTATGAAA ACCACCGACACCTATCCATCTCTGCCAAAGCCATTGAACAGGCCTCAAAAGGCAATTGCC GTCATGACTTCCGGTGGTGATGCTCCAGGTATGAACTCTAACGTTAGAGCCATCGTGCGT TCCGCTATCTTCAAAGGTTGTCGTGCCTTTGTTGTCATGGAAGGTTATGAAGGTTTGGTT CGTGGTGGTCCAGAATACATCAAGGAATTCCACTGGGAAGACGTCCGTGGTTGGTCTGCT GAAGGTGGTACCAACATTGGTACTGCCCGTTGTATGGAATTCAAGAAGCGCGAAGGTAGA TTATTGGGTGCCCAACATTTGATTGAGGCCGGTGTCGATGCTTTGATCGTTTGTGGTGGT GACGGTTCTTTGACTGGTGCTGATCTGTTTAGATCAGAATGGCCTTCTTTGATCGAGGAA TTGTTGAAAACAAACAGAATTTCCAACGAACAATACGAAAGAATGAAGCATTTGAATATT TGCGGTACTGTCGGTTCTATTGATAACGATATGTCCACCACGGATGCTACTATTGGTGCT TACTCTGCCTTGGACAGAATCTGTAAGGCCATCGATTACGTTGAAGCCACTGCCAACTCT CACTCAAGAGCTTTCGTTGTTGAAGTTATGGGTAGAAACTGTGGTTGGTTAGCTTTATTA GCTGGTATCGCCACTTCCGCTGACTATATCTTTATTCCAGAGAAGCCAGCCACTTCCAGC GAATGGCAAGATCAAATGTGTGACATTGTCTCCAAGCACAGATCAAGGGGTAAGAGAACC ACCATTGTTGTTGTTGCAGAAGGTGCTATCGCTGCTGACTTGACCCCAATTTCTCCAAGC GACGTCCACAAAGTTCTAGTTGACAGATTAGGTTTGGATACAAGAATTACTACCTTAGGT CACGTTCAAAGAGGTGGTACTGCTGTTGCTTACGACCGTATCTTGGCTACTTTACAAGGT CTTGAGGCCGTTAATGCCGTTTTGGAATCCACTCCAGACACCCCATCACCATTGATTGCT GTTAACGAAAACAAAATTGTTCGTAAACCATTAATGGAATCCGTCAAGTTGACCAAAGCA GTTGCAGAAGCCATTCAAGCTAAGGATTTCAAGAGAGCTATGTCTTTAAGAGACACTGAG TTCATTGAACATTTAAACAATTTCATGGCTATCAACTCTGCTGACCACAACGAACCAAAG CTACCAAAGGACAAGAGACTGAAGATTGCCATTGTTAATGTCGGTGCTCCAGCTGGTGGT ATCAACTCTGCCGTCTACTCGATGGCTACTTACTGTATGTCCCAAGGTCACAGACCATAC GCTATCTACAATGGTTGGTCTGGTTTGGCAAGACATGAAAGTGTTCGTTCTTTGAACTGG AAGGATATGTTGGGTTGGCAATCCCGTGGTGGTTCTGAAATCGGTACTAACAGAGTCACT CCAGAAGAAGCAGATCTAGGTATGATTGCTTACTATTTCCAAAAGTACGAATTTGATGGT TTGATCATCGTTGGTGGTTTCGAAGCTTTTGAATCTTTACATCAATTAGAGAGAGCAAGA GAAAGTTATCCAGCTTTCAGAATCCCAATGGTCTTGATACCAGCTACTTTGTCTAACAAT GTTCCAGGTACTGAATACTCTTTGGGTTCTGATACCGCTTTGAATGCTCTAATGGAATAC TGTGATGTTGTTAAACAATCCGCTTCTTCAACCAGAGGTAGAGCCTTCGTTGTCGATTGT CAAGGTGGTAACTCAGGCTATTTGGCCACTTACGCTTCTTTGGCTGTTGGTGCTCAAGTC TCTTATGTCCCAGAAGAAGGTATTTCTTTGGAGCAATTGTCCGAGGATATTGAATACTTA GCTCAATCTTTTGAAAAGGCAGAAGGTAGAGGTAGATTTGGTAAATTGATTTTGAAGAGT ACAAACGCTTCTAAGGCTTTATCAGCCACTAAATTGGCTGAAGTTATTACTGCTGAAGCC GATGGCAGATTTGACGCTAAGCCAGCTTATCCAGGTCATGTACAACAAGGTGGTTTGCCA TCTCCAATTGATAGAACAAGAGCCACTAGAATGGCCATTAAAGCTGTCGGCTTCATCGAA GACAACCAAGCTGCCATTGCTGAAGCTCGTGCTGCCGAAGAAAACTTCAACGCTGATGAC AAGACCATTTCTGACACTGCTGCTGTCGTTGGTGTTAAGGGTTCACATGTCGTTTACAAC TCCATTAGACAATTGTATGACTATGAAACTGAAGTTTCCATGAGAATGCCAAAGGTCATT CACTGGCAAGCTACCAGACTCATTGCTGACCATTTGGTTGGAAGAAAGAGAGTTGATTAA
Protein Properties
Pfam Domain Function
Protein Residues959
Protein Molecular Weight104617.0
Protein Theoretical pI6.65
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphofructokinase subunit beta MTVTTPFVNGTSYCTVTAYSVQSYKAAIDFYTKFLSLENRSSPDENSTLLSNDSISLKIL LRPDEKINKNVEAHLKELNSITKTQDWRSHATQSLVFNTSDILAVKDTLNAMNAPLQGYP TELFPMQLYTLDPLGNVVGVTSTKNAVSTKPTPPPAPEASAESGLSSKVHSYTDLAYRMK TTDTYPSLPKPLNRPQKAIAVMTSGGDAPGMNSNVRAIVRSAIFKGCRAFVVMEGYEGLV RGGPEYIKEFHWEDVRGWSAEGGTNIGTARCMEFKKREGRLLGAQHLIEAGVDALIVCGG DGSLTGADLFRSEWPSLIEELLKTNRISNEQYERMKHLNICGTVGSIDNDMSTTDATIGA YSALDRICKAIDYVEATANSHSRAFVVEVMGRNCGWLALLAGIATSADYIFIPEKPATSS EWQDQMCDIVSKHRSRGKRTTIVVVAEGAIAADLTPISPSDVHKVLVDRLGLDTRITTLG HVQRGGTAVAYDRILATLQGLEAVNAVLESTPDTPSPLIAVNENKIVRKPLMESVKLTKA VAEAIQAKDFKRAMSLRDTEFIEHLNNFMAINSADHNEPKLPKDKRLKIAIVNVGAPAGG INSAVYSMATYCMSQGHRPYAIYNGWSGLARHESVRSLNWKDMLGWQSRGGSEIGTNRVT PEEADLGMIAYYFQKYEFDGLIIVGGFEAFESLHQLERARESYPAFRIPMVLIPATLSNN VPGTEYSLGSDTALNALMEYCDVVKQSASSTRGRAFVVDCQGGNSGYLATYASLAVGAQV SYVPEEGISLEQLSEDIEYLAQSFEKAEGRGRFGKLILKSTNASKALSATKLAEVITAEA DGRFDAKPAYPGHVQQGGLPSPIDRTRATRMAIKAVGFIKDNQAAIAEARAAEENFNADD KTISDTAAVVGVKGSHVVYNSIRQLYDYETEVSMRMPKVIHWQATRLIADHLVGRKRVD
References
External Links
ResourceLink
Saccharomyces Genome Database PFK2
Uniprot IDP16862
Uniprot NameK6PF2_YEAST
GenBank Gene IDM26944
Genebank Protein ID172140
General Reference
  • Heinisch, J., Ritzel, R. G., von Borstel, R. C., Aguilera, A., Rodicio, R., Zimmermann, F. K. (1989). "The phosphofructokinase genes of yeast evolved from two duplication events." Gene 78:309-321.2528496
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Kopperschlager, G., Bar, J., Stellwagen, E. (1993). "Limited proteolysis of yeast phosphofructokinase. Sequence locations of cleavage sites created by the actions of different proteinases." Eur J Biochem 217:527-533.8223596
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956