You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name6-phosphofructokinase subunit alpha
Synonyms
  • 6PF-1-K subunit alpha
  • Phosphofructokinase 1
  • Phosphohexokinase
Gene NamePFK1
Enzyme Class
Biological Properties
General FunctionInvolved in 6-phosphofructokinase activity
Specific FunctionATP + D-fructose 6-phosphate = ADP + D- fructose 1,6-bisphosphate
Cellular LocationCytoplasm
SMPDB Pathways
Glycolysis IPW002386 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
Pentose phosphate pathwayec00030 Map00030
SMPDB Reactions
Fructose 6-phosphate + Adenosine triphosphateFructose 1,6-bisphosphate + ADP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00108Fructose 1,6-bisphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00687D-fructose 1,6-bisphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
intracellular part
cytoplasm
macromolecular complex
protein complex
6-phosphofructokinase complex
cell part
Function
phosphotransferase activity, alcohol group as acceptor
phosphofructokinase activity
catalytic activity
transferase activity
6-phosphofructokinase activity
transferase activity, transferring phosphorus-containing groups
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR240C
Gene Sequence>2964 bp ATGCAATCTCAAGATTCATGCTACGGTGTTGCATTCAGATCTATCATCACAAATGATGAA GCTTTATTCAAGAAGACCATTCACTTTTATCACACTCTAGGATTTGCAACTGTGAAAGAT TTCAACAAATTCAAACATGGTGAAAATAGCTTACTATCTTCAGGGACTTCCCAAGATTCC TTGAGAGAAGTTTGGTTAGAATCTTTCAAGTTGAGTGAGGTTGATGCTTCTGGGTTCCGT ATACCACAACAAGAAGCTACTAACAAGGCTCAAAGTCAAGGTGCTCTATTAAAGATTCGT TTAGTGATGTCTGCTCCAATCGATGAAACTTTCGACACCAACGAAACCGCCACAATCACT TATTTCTCTACTGATTTGAACAAGATTGTCGAGAAATTCCCAAAACAAGCCGAAAAATTG TCCGATACCTTAGTGTTTTTGAAAGATCCAATGGGCAACAACATCACCTTCTCAGGCTTA GCTAATGCAACCGATTCCGCTCCAACTTCCAAAGATGCTTTCTTAGAAGCTACCTCCGAA GACGAAATCATCTCTAGAGCTTCTTCCGATGCTTCTGACTTACTAAGACAAACATTGGGC TCTTCTCAAAAGAAGAAGAAGATTGCTGTCATGACTTCTGGTGGTGATTCTCCAGGTATG AATGCCGCTGTTCGTGCCGTTGTTCGTACAGGTATACATTTCGGCTGTGATGTTTTTGCT GTTTACGAAGGTTACGAAGGTTTACTAAGAGGCGGTAAATATTTAAAGAAAATGGCTTGG GAAGATGTCAGAGGTTGGTTAAGTGAAGGTGGTACTTTGATTGGTACTGCTCGTTCTATG GAATTCAGAAAGCGTGAGGGTCGTAGACAAGCTGCAGGCAATTTAATTTCGCAAGGTATT GACGCTTTGGTTGTTTGTGGTGGTGATGGTTCTTTAACCGGTGCTGATCTTTTCAGACAC GAATGGCCATCTTTGGTTGATGAATTGGTTGCAGAAGGTAGATTCACTAAAGAAGAAGTC GCCCCATACAAGAATTTGTCCATTGTTGGTCTTGTCGGTTCCATCGATAATGATATGTCT GGTACTGACTCTACCATTGGTGCTTATTCTGCTTTGGAAAGAATCTGTGAAATGGTTGAC TACATTGATGCCACCGCTAAATCCCACTCCCGTGCCTTTGTTGTTGAAGTTATGGGTAGA CATTGTGGTTGGTTGGCCTTGATGGCTGGTATTGCTACCGGTGCCGATTACATTTTTATT CCAGAAAGAGCTGTTCCTCACGGAAAATGGCAGGACGAATTGAAGGAAGTGTGCCAAAGA CACAGAAGTAAGGGTAGAAGAAATAACACAATTATTGTCGCTGAAGGTGCTTTAGATGAT CAATTAAACCCTGTTACTGCCAATGACGTCAAAGATGCTTTGATTGAATTGGGTCTAGAC ACCAAGGTAACCATTCTAGGTCACGTTCAAAGAGGTGGTACAGCTGTTGCTCATGACAGA TGGTTAGCTACTCTACAAGGTGTCGATGCTGTTAAGGCCGTTCTGGAATTTACCCCTGAA ACTCCTTCTCCATTAATTGGTATTTTAGAAAACAAGATAATTAGAATGCCATTGGTTGAA TCTGTGAAGTTGACTAAATCTGTTGCCACTGCCATTGAAAACAAAGATTTCGATAAGGCA ATTTCTTTAAGAGACACAGAATTTATTGAACTTTACGAAAACTTCTTATCCACTACCGTT AAAGATGATGGTTCCGAATTATTGCCAGTATCTGACAGACTAAACATTGGTATTGTCCAT GTTGGTGCCCCATCTGCTGCTTTGAACGCTGCCACCCGTGCCGCAACTCTATACTGTTTG TCTCACGGCCATAAACCATACGCTATCATGAATGGTTTCAGTGGATTGATTCAAACCGGT GAAGTGAAGGAACTATCATGGATTGATGTCGAAAACTGGCATAACTTGGGTGGTTCCGAA ATCGGTACGAACAGATCTGTTGCTTCAGAAGATTTGGGTACCATTGCTTACTACTTCCAA AAGAACAAGCTAGACGGTTTGATTATTCTTGGTGGTTTTGAAGGTTTCAGGTCCTTGAAG CAATTGCGTGACGGTAGAACCCAACACCCAATCTTTAACATTCCAATGTGTTTGATTCCA GCCACTGTTTCTAATAACGTTCCAGGTACTGAATACTCACTTGGTGTTGATACCTGTTTG AACGCATTAGTCAATTACACTGATGACATCAAACAAAGTGCTTCTGCCACAAGAAGAAGA GTCTTCGTCTGTGAAGTCCAAGGTGGTCACTCTGGTTACATCGCTTCTTTCACCGGTTTA ATCACTGGTGCTGTTTCCGTGTACACTCCAGAAAAGAAGATCGACTTAGCTTCTATCAGA GAAGATATAACTCTATTAAAAGAGAACTTCCGTCACGACAAAGGTGAAAACAGAAACGGT AAGCTATTGGTTAGAAACGAACAAGCTTCTAGCGTATATAGCACTCAATTGTTGGCTGAC ATCATCTCTGAAGCAAGCAAGGGTAAGTTTGGTGTTAGAACTGCTATCCCAGGCCATGTT CAACAAGGTGGTGTTCCATCTTCTAAAGACCGTGTCACCGCTTCCAGATTTGCTGTCAAA TGTATCAAGTTTATCGAACAATGGAACAAGAAAAATGAAGCTTCTCCAAACACTGACGCT AAGGTTTTGAGATTCAAGTTCGATACTCACGGTGAAAAGGTACCAACTGTTGAGCACGAA GATGACTCTGCTGCTGTTATCTGTGTTAATGGTTCTCACGTTTCCTTCAAGCCAATTGCT AACCTTTGGGAAAACGAAACCAACGTTGAATTAAGAAAGGGTTTTGAAGTTCACTGGGCT GAATACAACAAGATTGGTGACATCCTGTCCGGTAGATTAAAGTTGAGAGCTGAGGTAGCC GCTTTAGCCGCTGAAAACAAATGA
Protein Properties
Pfam Domain Function
Protein Residues987
Protein Molecular Weight107969.0
Protein Theoretical pI6.35
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>6-phosphofructokinase subunit alpha MQSQDSCYGVAFRSIITNDEALFKKTIHFYHTLGFATVKDFNKFKHGENSLLSSGTSQDS LREVWLESFKLSEVDASGFRIPQQEATNKAQSQGALLKIRLVMSAPIDETFDTNETATIT YFSTDLNKIVEKFPKQAEKLSDTLVFLKDPMGNNITFSGLANATDSAPTSKDAFLEATSE DEIISRASSDASDLLRQTLGSSQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFA VYEGYEGLLRGGKYLKKMAWEDVRGWLSEGGTLIGTARSMEFRKREGRRQAAGNLISQGI DALVVCGGDGSLTGADLFRHEWPSLVDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMS GTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIFI PERAVPHGKWQDELKEVCQRHRSKGRRNNTIIVAEGALDDQLNPVTANDVKDALIELGLD TKVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVLEFTPETPSPLIGILENKIIRMPLVE SVKLTKSVATAIENKDFDKAISLRDTEFIELYENFLSTTVKDDGSELLPVSDRLNIGIVH VGAPSAALNAATRAATLYCLSHGHKPYAIMNGFSGLIQTGEVKELSWIDVENWHNLGGSE IGTNRSVASEDLGTIAYYFQKNKLDGLIILGGFEGFRSLKQLRDGRTQHPIFNIPMCLIP ATVSNNVPGTEYSLGVDTCLNALVNYTDDIKQSASATRRRVFVCEVQGGHSGYIASFTGL ITGAVSVYTPEKKIDLASIREDITLLKENFRHDKGENRNGKLLVRNEQASSVYSTQLLAD IISEASKGKFGVRTAIPGHVQQGGVPSSKDRVTASRFAVKCIKFIEQWNKKNEASPNTDA KVLRFKFDTHGEKVPTVEHEDDSAAVICVNGSHVSFKPIANLWENETNVELRKGFEVHWA EYNKIGDILSGRLKLRAEVAALAAENK
References
External Links
ResourceLink
Saccharomyces Genome Database PFK1
Uniprot IDP16861
Uniprot NameK6PF1_YEAST
GenBank Gene IDM26943
Genebank Protein ID172138
General Reference
  • Heinisch, J., Ritzel, R. G., von Borstel, R. C., Aguilera, A., Rodicio, R., Zimmermann, F. K. (1989). "The phosphofructokinase genes of yeast evolved from two duplication events." Gene 78:309-321.2528496
  • Guerreiro, P., Azevedo, D., Barreiros, T., Rodrigues-Pousada, C. (1997). "Sequencing of a 9.9 kb segment on the right arm of yeast chromosome VII reveals four open reading frames, including PFK1, the gene coding for succinyl-CoA synthetase (beta-chain) and two ORFs sharing homology with ORFs of the yeast chromosome VIII." Yeast 13:275-280.9090057
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • van der Aart, Q. J., Kleine, K., Steensma, H. Y. (1996). "Sequence analysis of the 43 kb CRM1-YLM9-PET54-DIE2-SMI1-PHO81-YHB4-PFK1 region from the right arm of Saccharomyces cerevisiae chromosome VII." Yeast 12:385-390.8701610
  • Kopperschlager, G., Bar, J., Stellwagen, E. (1993). "Limited proteolysis of yeast phosphofructokinase. Sequence locations of cleavage sites created by the actions of different proteinases." Eur J Biochem 217:527-533.8223596
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956