You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA-splicing endonuclease subunit SEN2
Synonyms
  • Splicing endonuclease protein 2
  • tRNA-intron endonuclease SEN2
Gene NameSEN2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleic acid binding
Specific FunctionConstitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3' cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. This subunit may anchor the endonuclease complex to the nuclear membrane. Probably carries the active site for 5'-splice site cleavage
Cellular LocationNucleus. Endomembrane system; Peripheral membrane protein. Mitochondrion outer membrane; Peripheral membrane protein; Cytoplasmic side.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00890waterShow
GO Classification
Component
macromolecular complex
protein complex
tRNA-intron endonuclease complex
Function
nucleic acid binding
nuclease activity
catalytic activity
ribonuclease activity
tRNA-specific ribonuclease activity
tRNA-intron endonuclease activity
binding
hydrolase activity
hydrolase activity, acting on ester bonds
Process
RNA processing
RNA splicing
RNA splicing, via endonucleolytic cleavage and ligation
tRNA splicing, via endonucleolytic cleavage and ligation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR105C
Gene Sequence>1134 bp ATGTCTAAAGGGAGGGTCAATCAGAAGCGTTACAAGTATCCTCTTCCAATTCACCCCGTA GATGACCTTCCAGAGTTAATCCTTCATAATCCGTTATCTTGGCTATATTGGGCATACCGC TATTACAAGAGTACGAACGCACTGAACGATAAAGTACATGTAGATTTTATAGGAGATACC ACTCTTCACATCACGGTTCAAGATGACAAGCAAATGCTATATCTTTGGAATAATGGATTT TTTGGCACTGGTCAATTTAGCAGGAGTGAGCCTACATGGAAAGCTAGAACAGAGGCCAGA CTGGGTCTCAATGATACTCCCCTCCACAATCGGGGAGGAACAAAGAGTAATACTGAAACG GAGATGACTTTAGAGAAGGTCACACAACAGAGGAGATTACAAAGATTAGAGTTCAAGAAA GAACGTGCGAAGTTAGAAAGAGAATTACTAGAATTAAGAAAAAAAGGTGGTCATATCGAT GAGGAAAACATCCTCCTTGAGAAACAACGAGAATCATTAAGAAAATTTAAACTAAAACAA ACAGAAGACGTGGGCATCGTTGCACAACAGCAAGACATTTCCGAATCAAATTTAAGAGAT GAAGACAACAATCTTCTTGATGAGAACGGTGATCTTTTGCCACTAGAGTCACTAGAACTA ATGCCAGTGGAAGCTATGTTTTTAACTTTTGCACTTCCTGTTCTTGACATATCTCCCGCG TGCCTGGCAGGGAAACTGTTTCAATTCGATGCCAAATATAAAGATATTCACTCCTTTGTC AGATCATACGTTATATACCATCACTACAGATCACACGGTTGGTGCGTAAGATCTGGTATA AAATTCGGCTGCGATTATTTATTATATAAGAGAGGGCCACCATTTCAACACGCTGAATTT TGTGTTATGGGTCTTGACCACGACGTCTCTAAAGATTATACGTGGTATTCTAGCATAGCC CGTGTTGTGGGCGGCGCAAAGAAGACGTTTGTGTTATGCTACGTGGAGAGACTAATCTCG GAACAGGAGGCGATAGCACTATGGAAATCAAACAACTTTACTAAATTGTTCAATAGTTTT CAAGTTGGTGAAGTATTGTATAAGAGATGGGTTCCCGGAAGAAATAGAGACTAG
Protein Properties
Pfam Domain Function
Protein Residues377
Protein Molecular Weight44109.0
Protein Theoretical pI8.62
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA-splicing endonuclease subunit SEN2 MSKGRVNQKRYKYPLPIHPVDDLPELILHNPLSWLYWAYRYYKSTNALNDKVHVDFIGDT TLHITVQDDKQMLYLWNNGFFGTGQFSRSEPTWKARTEARLGLNDTPLHNRGGTKSNTET EMTLEKVTQQRRLQRLEFKKERAKLERELLELRKKGGHIDEENILLEKQRESLRKFKLKQ TEDVGIVAQQQDISESNLRDEDNNLLDENGDLLPLESLELMPVEAMFLTFALPVLDISPA CLAGKLFQFDAKYKDIHSFVRSYVIYHHYRSHGWCVRSGIKFGCDYLLYKRGPPFQHAEF CVMGLDHDVSKDYTWYSSIARVVGGAKKTFVLCYVERLISEQEAIALWKSNNFTKLFNSF QVGEVLYKRWVPGRNRD
References
External Links
ResourceLink
Saccharomyces Genome Database SEN2
Uniprot IDP16658
Uniprot NameSEN2_YEAST
GenBank Gene IDM32336
Genebank Protein ID172576
General Reference
  • Trotta, C. R., Miao, F., Arn, E. A., Stevens, S. W., Ho, C. K., Rauhut, R., Abelson, J. N. (1997). "The yeast tRNA splicing endonuclease: a tetrameric enzyme with two active site subunits homologous to the archaeal tRNA endonucleases." Cell 89:849-858.9200603
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Rauhut, R., Green, P. R., Abelson, J. (1990). "Yeast tRNA-splicing endonuclease is a heterotrimeric enzyme." J Biol Chem 265:18180-18184.2211694
  • Ho, C. K., Rauhut, R., Vijayraghavan, U., Abelson, J. (1990). "Accumulation of pre-tRNA splicing '2/3' intermediates in a Saccharomyces cerevisiae mutant." EMBO J 9:1245-1252.2182322
  • Yoshihisa, T., Yunoki-Esaki, K., Ohshima, C., Tanaka, N., Endo, T. (2003). "Possibility of cytoplasmic pre-tRNA splicing: the yeast tRNA splicing endonuclease mainly localizes on the mitochondria." Mol Biol Cell 14:3266-3279.12925762
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106