You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtein APA1
Synonyms
  • 5',5'''-P-1,P-4-tetraphosphate phosphorylase
  • ATP adenylyltransferase
  • Diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase
  • AP,A phosphorylase
  • AP-4-A phosphorylase
  • ADP-sulfurylase
Gene NameAPA1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP adenylyltransferase activity
Specific FunctionAp4A phosphorylase catabolizes Ap4N nucleotides (where N is A,C,G or U). Additionally this enzyme catalyzes the conversion of adenosine-5-phosphosulfate (AMPs) plus Pi to ADP plus sulfate, the exchange of NDP and phosphate and the synthesis of Ap4A from AMPs plus ATP
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
GTP + hydron + ADPP(1)-(5'-adenosyl),P(4)-(5'-guanosyl) tetraphosphate + phosphate
GTP + hydron + Guanosine diphosphatephosphate + P(1),P(4)-bis(5'-guanosyl) tetraphosphate
hydron + Sulfate + ADPAdenosine phosphosulfate + phosphate
Metabolites
YMDB IDNameView
YMDB00005SulfateShow
YMDB00109Adenosine triphosphateShow
YMDB00225P1,P4-Bis(5'-adenosyl) tetraphosphateShow
YMDB00256Adenosine phosphosulfateShow
YMDB00257Guanosine diphosphateShow
YMDB003235'-adenylyl sulfateShow
YMDB00558GTPShow
YMDB00590P(1),P(4)-bis(5'-adenosyl) tetraphosphateShow
YMDB00599P(1)-(5'-adenosyl),P(4)-(5'-guanosyl) tetraphosphateShow
YMDB00600P(1),P(4)-bis(5'-guanosyl) tetraphosphateShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
ATP binding
catalytic activity
nucleotidyltransferase activity
transferase activity
adenylyltransferase activity
transferase activity, transferring phosphorus-containing groups
ATP adenylyltransferase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 3
LocusYCL050C
Gene Sequence>966 bp ATGAGTATCCCCGCTGACATTGCATCTTTAATTAGTGACAAGTACAAAAGTGCCTTCGAT AATGGTAACTTAAAATTTATCCAGACTGAAACAACGAAAACAAAGGACCCAAAAACCAGC ATGCCATACTTGATTAGTCACATGCCAAGTCTGATCGAAAAGCCAGAGCGTGGCCAAACT CCAGAAGGAGAGGATCCACTAGGCAAACCTGAGGAAGAATTAACGGTTATCCCAGAATTT GGTGGTGCCGATAACAAAGCGTATAAATTGCTATTAAACAAATTCCCTGTAATCCCTGAA CACACTTTATTGGTAACTAACGAATACCAACATCAAACTGATGCCTTGACCCCAACCGAT TTATTGACTGCTTATAAGTTGCTGTGTGCCTTGGACAATGAAGAATCCGACAAGAGACAC ATGGTCTTTTACAATTCTGGTCCAGCCAGTGGTTCTTCATTGGACCACAAACATTTGCAA ATTCTGCAAATGCCTGAAAAGTTCGTCACTTTCCAAGATAGACTATGTAATGGTAAAGAA CATTTCCTACCAACTTTCAATACTGAACCTTTGCAAGATGCTAAAGTCTCGTTCGCTCAT TTTGTCTTGCCAATGCCGGAGTCTGAAGAAACTGTTGATGAAGACCTATTAGCTATGTGT TACATCTCCATATTGCAAAGAGCTTTGACCTTTTTCCAGGACTGGTTGAACGAAAATCCA GAACTAAAGAAATCCTACAATCTTATGTTAACCAAGGAATGGATCTGTGTCGTTCCACGC TCGAAGGCCTTTTCTGATGAAATGAAGATAGGTTTCAACTCCACAGGTTATTGTGGTATG ATCTTAACCAAAAATGATGAAGTTTTCTCCAAGATTACTGAAAAACCTGAATTGATTAAC GATATCTTATTGGAATGTGGTTTCCCAAACACTTCTGGTCAAAAACCAAACGAATACAAC TATTGA
Protein Properties
Pfam Domain Function
Protein Residues321
Protein Molecular Weight36492.19922
Protein Theoretical pI4.66
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Protein APA1 MSIPADIASLISDKYKSAFDNGNLKFIQTETTKTKDPKTSMPYLISHMPSLIEKPERGQT PEGEDPLGKPEEELTVIPEFGGADNKAYKLLLNKFPVIPEHTLLVTNEYQHQTDALTPTD LLTAYKLLCALDNEESDKRHMVFYNSGPASGSSLDHKHLQILQMPEKFVTFQDRLCNGKE HFLPTFNTEPLQDAKVSFAHFVLPMPESEETVDEDLLAMCYISILQRALTFFQDWLNENP ELKKSYNLMLTKEWICVVPRSKAFSDEMKIGFNSTGYCGMILTKNDEVFSKITEKPELIN DILLECGFPNTSGQKPNEYNY
References
External Links
ResourceLink
Saccharomyces Genome Database APA1
Uniprot IDP16550
Uniprot NameAPA1_YEAST
GenBank Gene IDM31791
Genebank Protein ID171064
General Reference
  • Kaushal, V., Avila, D. M., Hardies, S. C., Barnes, L. D. (1990). "Sequencing and enhanced expression of the gene encoding diadenosine 5',5'''-P1, P4-tetraphosphate (Ap4A) phosphorylase in Saccharomyces cerevisiae." Gene 95:79-84.2174812
  • Plateau, P., Fromant, M., Schmitter, J. M., Buhler, J. M., Blanquet, S. (1989). "Isolation, characterization, and inactivation of the APA1 gene encoding yeast diadenosine 5',5'''-P1,P4-tetraphosphate phosphorylase." J Bacteriol 171:6437-6445.2556364
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956