You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePyruvate dehydrogenase E1 component subunit alpha, mitochondrial
Synonyms
  • Pyruvate dehydrogenase complex component E1 alpha
  • PDHE1-A
Gene NamePDA1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
Specific FunctionThe pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2)
Cellular LocationMitochondrion matrix
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Butanoate metabolismec00650 Map00650
Citrate cycle (TCA cycle)ec00020 Map00020
Glycolysis / Gluconeogenesisec00010 Map00010
Pyruvate metabolismec00620 Map00620
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00175Pyruvic acidShow
YMDB00515(6R)-5,10-Methenyltetrahydrofolic acidShow
YMDB005165-Formyltetrahydrofolic acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00912Carbon dioxideShow
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
Function
oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor
pyruvate dehydrogenase activity
catalytic activity
pyruvate dehydrogenase (acetyl-transferring) activity
oxidoreductase activity
oxidoreductase activity, acting on the aldehyde or oxo group of donors
Process
metabolic process
oxidation reduction
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
Gene Properties
Chromosome Locationchromosome 5
LocusYER178W
Gene Sequence>1263 bp ATGCTTGCTGCTTCATTCAAACGCCAACCATCACAATTGGTCCGCGGGTTAGGAGCTGTT CTTCGCACTCCCACCAGGATAGGTCATGTTCGTACCATGGCAACTTTAAAAACAACTGAT AAGAAGGCCCCTGAGGACATCGAGGGCTCGGACACAGTGCAAATTGAGTTGCCTGAATCT TCCTTCGAGTCGTATATGCTAGAGCCTCCAGACTTGTCTTATGAGAGTTCGAAAGCGACC TTGTTACAGATGTATAAAGATATGGTCATCATCAGAAGAATGGAGATGGCTTGTGACGCC TTGTACAAGGCCAAGAAAATCAGAGGTTTTTGCCATCTATCTGTTGGTCAGGAGGCCATT GCTGTCGGTATCGAGAATGCCATCACAAAATTGGATTCCATCATCACATCTTACAGATGT CACGGTTTCACTTTTATGAGAGGTGCCTCAGTGAAAGCCGTTCTGGCTGAATTAATGGGT AGAAGAGCCGGTGTCTCTTATGGTAAGGGTGGTTCCATGCACCTTTACGCTCCAGGCTTC TATGGTGGTAATGGTATCGTGGGTGCCCAGGTTCCTTTAGGTGCAGGTTTAGCTTTTGCT CACCAATACAAGAACGAGGACGCCTGCTCTTTCACTTTGTATGGTGATGGTGCCTCTAAT CAAGGTCAAGTTTTTGAATCTTTCAACATGGCCAAATTATGGAATTTGCCGGTCGTGTTT TGCTGTGAGAACAACAAGTACGGTATGGGTACCGCCGCTTCAAGATCCTCCGCGATGACT GAATATTTCAAGCGTGGTCAATATATTCCAGGTTTAAAAGTTAACGGTATGGATATTCTA GCTGTCTACCAAGCATCCAAGTTTGCTAAGGACTGGTGTCTATCCGGCAAAGGTCCTCTC GTTCTAGAATATGAAACCTATAGGTACGGTGGCCATTCTATGTCTGATCCCGGTACTACC TACAGAACTAGAGACGAGATTCAGCATATGAGATCCAAGAACGATCCAATTGCTGGTCTT AAGATGCATTTGATTGATCTAGGTATTGCCACTGAAGCTGAAGTCAAAGCTTACGACAAG TCCGCTAGAAAATACGTTGACGAACAAGTTGAATTAGCTGATGCTGCTCCTCCTCCAGAA GCCAAATTATCCATCTTGTTTGAAGACGTCTACGTGAAAGGTACAGAAACTCCAACCCTA AGAGGTAGGATCCCTGAAGATACTTGGGACTTCAAAAAGCAAGGTTTTGCCTCTAGGGAT TAA
Protein Properties
Pfam Domain Function
Protein Residues420
Protein Molecular Weight46342.69922
Protein Theoretical pI8.24
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial MLAASFKRQPSQLVRGLGAVLRTPTRIGHVRTMATLKTTDKKAPEDIEGSDTVQIELPES SFESYMLEPPDLSYETSKATLLQMYKDMVIIRRMEMACDALYKAKKIRGFCHLSVGQEAI AVGIENAITKLDSIITSYRCHGFTFMRGASVKAVLAELMGRRAGVSYGKGGSMHLYAPGF YGGNGIVGAQVPLGAGLAFAHQYKNEDACSFTLYGDGASNQGQVFESFNMAKLWNLPVVF CCENNKYGMGTAASRSSAMTEYFKRGQYIPGLKVNGMDILAVYQASKFAKDWCLSGKGPL VLEYETYRYGGHSMSDPGTTYRTRDEIQHMRSKNDPIAGLKMHLIDLGIATEAEVKAYDK SARKYVDEQVELADAAPPPEAKLSILFEDVYVKGTETPTLRGRIPEDTWDFKKQGFASRD
References
External Links
ResourceLink
Saccharomyces Genome Database PDA1
Uniprot IDP16387
Uniprot NameODPA_YEAST
GenBank Gene IDM29582
Genebank Protein ID172108
General Reference
  • Behal, R. H., Browning, K. S., Reed, L. J. (1989). "Nucleotide and deduced amino acid sequence of the alpha subunit of yeast pyruvate dehydrogenase." Biochem Biophys Res Commun 164:941-946.2684159
  • Wenzel, T. J., Zuurmond, A. M., Bergmans, A., van den Berg, J. A., Steensma, H. Y. (1994). "Promoter analysis of the PDA1 gene encoding the E1 alpha subunit of the pyruvate dehydrogenase complex from Saccharomyces cerevisiae." Yeast 10:297-308.8017100
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Bishop, D. K., Park, D., Xu, L., Kleckner, N. (1992). "DMC1: a meiosis-specific yeast homolog of E. coli recA required for recombination, synaptonemal complex formation, and cell cycle progression." Cell 69:439-456.1581960
  • Kobayashi, T., Hotta, Y., Tabata, S. (1993). "Isolation and characterization of a yeast gene that is homologous with a meiosis-specific cDNA from a plant." Mol Gen Genet 237:225-232.8455558
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956