You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThreonine synthase
Synonyms
  • TS
Gene NameTHR4
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the gamma-elimination of phosphate from L- phosphohomoserine and the beta-addition of water to produce L- threonine
Cellular LocationNot Available
SMPDB Pathways
threonine metabolismPW002401 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Vitamin B6 metabolismec00750 Map00750
SMPDB Reactions
O-Phosphohomoserine + waterphosphate + L-Threonine
KEGG Reactions
water + O-Phospho-4-hydroxy-L-threoninephosphate + 4-Hydroxy-L-threonine
water + O-Phosphohomoserinephosphate + L-Threonine
Metabolites
YMDB IDNameView
YMDB00214L-ThreonineShow
YMDB00258O-PhosphohomoserineShow
YMDB00355O-Phospho-4-hydroxy-L-threonineShow
YMDB004944-Hydroxy-L-threonineShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
lyase activity
binding
cofactor binding
pyridoxal phosphate binding
carbon-oxygen lyase activity
carbon-oxygen lyase activity, acting on phosphates
threonine synthase activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
aspartate family amino acid metabolic process
threonine metabolic process
threonine biosynthetic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR053W
Gene Sequence>1545 bp ATGCCTAACGCTTCCCAAGTTTACAGATCTACCAGATCCAGCTCTCCAAAGACAATCTCT TTTGAAGAGGCTATCATTCAAGGTCTGGCCACTGACGGTGGTCTTTTCATTCCACCAACT ATTCCACAAGTGGACCAAGCCACTCTTTTCAATGATTGGTCAAAGCTCTCCTTCCAAGAC TTAGCCTTTGCTATCATGAGACTATACATTGCCCAAGAAGAGATTCCAGATGCTGATCTA AAGGACTTGATCAAGAGATCTTATTCTACTTTCCGTTCTGATGAAGTCACCCCCTTGGTG CAAAACGTCACTGGTGACAAGGAGAATTTGCACATTTTAGAATTATTCCACGGTCCTACC TACGCTTTCAAAGACGTTGCTTTACAATTTGTCGGTAATCTTTTTGAATACTTCTTACAA AGAACCAACGCCAATTTACCTGAAGGCGAGAAAAAGCAAATCACTGTGGTCGGTGCTACT TCCGGTGACACTGGTTCTGCAGCCATCTACGGTTTAAGAGGCAAAAAGGACGTTTCCGTT TTCATCTTATATCCAACCGGTAGAATTTCCCCAATTCAAGAAGAACAAATGACCACCGTT CCAGATGAAAACGTCCAGACTTTGTCTGTTACCGGTACTTTCGACAACTGTCAAGATATC GTCAAAGCTATTTTCGGTGACAAAGAATTCAACTCTAAACACAACGTCGGTGCTGTTAAC TCCATCAACTGGGCAAGAATCTTGGCCCAAATGACCTATTACTTTTATTCATTCTTCCAA GCCACCAACGGTAAGGACTCCAAGAAGGTCAAGTTCGTTGTGCCAAGTGGGAACTTCGGT GATATATTGGCCGGTTATTTTGCCAAGAAAATGGGTTTGCCTATTGAAAAACTGGCCATC GCTACCAATGAAAACGACATTTTGGACAGATTTTTGAAATCTGGTCTATACGAAAGATCA GACAAGGTTGCTGCTACTTTATCCCCAGCAATGGATATCTTAATCTCTTCTAACTTTGAA AGACTACTATGGTACCTAGCTCGTGAATACCTAGCTAATGGTGATGATTTGAAAGCCGGT GAAATCGTCAACAATTGGTTCCAGGAATTGAAGACCAACGGTAAGTTCCAAGTTGACAAA TCCATCATTGAAGGCGCATCAAAGGACTTTACATCAGAAAGAGTTTCCAATGAAGAAACA TCTGAAACAATCAAGAAGATCTACGAATCATCTGTAAATCCAAAACATTACATCTTAGAT CCTCACACAGCTGTCGGTGTTTGCGCCACAGAAAGATTGATTGCAAAAGATAATGACAAG TCCATCCAATACATTTCTCTATCTACCGCTCACCCAGCTAAATTTGCCGATGCTGTAAAC AATGCATTGTCTGGATTTTCCAATTATTCATTTGAAAAGGATGTTTTGCCTGAGGAATTG AAGAAACTATCCACATTAAAGAAGAAATTAAAATTCATCGAAAGAGCTGACGTTGAATTG GTCAAAAACGCTATTGAAGAAGAACTTGCTAAAATGAAATTATAA
Protein Properties
Pfam Domain Function
Protein Residues514
Protein Molecular Weight57473.69922
Protein Theoretical pI5.3
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Threonine synthase MPNASQVYRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQD LAFAIMRLYIAQEEIPDADLKDLIKRSYSTFRSDEVTPLVQNVTGDKENLHILELFHGPT YAFKDVALQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGKKDVSV FILYPTGRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVN SINWARILAQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAI ATNENDILDRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGDDLKAG EIVNNWFQELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIKKIYESSVNPKHYILD PHTAVGVCATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDVLPEEL KKLSTLKKKLKFIERADVELVKNAIEEELAKMKL
References
External Links
ResourceLink
Saccharomyces Genome Database THR4
Uniprot IDP16120
Uniprot NameTHRC_YEAST
GenBank Gene IDX17256
Genebank Protein ID4616
PDB ID
1KL7
General Reference
  • Aas, S. F., Rognes, S. E. (1990). "Nucleotide sequence of the yeast THR4 gene encoding threonine synthase." Nucleic Acids Res 18:665.2408022
  • Mannhaupt, G., van der Linden, G., Vetter, I., Maurer, K., Pilz, U., Planta, R., Feldmann, H. (1990). "Analysis of the THR4 region on chromosome III of the yeast Saccharomyces cerevisiae." Yeast 6:353-361.2204248
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956