You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucan 1,3-beta-glucosidase
Synonyms
  • Exo-1,3-beta-glucanase
  • GP29
  • Soluble cell wall protein 9
Gene NameBGL2
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionGlucanases possibly play a role in cell expansion during growth, in cell-cell fusion during mating, and in spore release during sporulation. This enzyme may be involved in beta-glucan degradation and also function biosynthetically as a transglycosylase
Cellular LocationSecreted, cell wall.
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Alpha-D-Glucose + 1,3-beta-D-Glucan1,3-beta-D-Glucan + water
KEGG Reactions
water + (1->3)-beta-D-glucan D-Glucose
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
YMDB163141,3-beta-D-GlucanShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
binding
ion binding
cation binding
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR282C
Gene Sequence>942 bp ATGCGTTTCTCTACTACACTCGCTACTGCAGCTACTGCGCTATTTTTCACAGCCTCCCAA GTTTCAGCTATTGGTGAACTAGCCTTTAACTTGGGTGTCAAGAACAACGATGGTACTTGT AAGTCCACTTCCGACTATGAAACCGAATTACAAGCTTTGAAGAGCTACACTTCCACCGTC AAAGTTTACGCTGCCTCAGATTGTAACACTTTGCAAAACTTAGGTCCTGCTGCTGAAGCT GAGGGATTTACTATCTTTGTCGGTGTTTGGCCAACAGACGACAGTCATTACGCTGCTGAA AAGGCTGCTTTGCAAACCTATTTGCCAAAAATTAAAGAATCCACTGTTGCTGGTTTCTTG GTTGGTTCTGAAGCCTTATACCGTAACGATTTGACTGCCTCTCAATTATCAGACAAAATT AATGACGTCCGTAGTGTCGTTGCTGACATTTCCGATTCTGACGGAAAGTCATACTCTGGT AAGCAAGTCGGTACTGTCGATTCCTGGAATGTTTTGGTTGCTGGTTACAATTCTGCCGTT ATCGAAGCTTCCGATTTTGTTATGGCTAACGCGTTCTCCTACTGGCAAGGTCAAACCATG CAAAATGCCTCTTACTCATTCTTTGATGATATTATGCAAGCTCTACAGGTTATCCAATCT ACTAAAGGTTCTACCGATATTACCTTCTGGGTTGGTGAGACCGGTTGGCCAACTGATGGT ACCAACTTTGAAAGTTCTTACCCATCTGTTGACAACGCCAAACAATTCTGGAAAGAAGGT ATCTGTTCCATGAGAGCTTGGGGTGTTAACGTTATTGTTTTTGAAGCCTTTGATGAAGAT TGGAAGCCAAACACCTCTGGTACCTCTGATGTCGAGAAGCACTGGGGTGTTTTCACTTCA AGTGACAATTTGAAATACTCCTTGGACTGTGACTTTTCATGA
Protein Properties
Pfam Domain Function
Protein Residues313
Protein Molecular Weight34118.30078
Protein Theoretical pI4.1
Signalling Regions
  • 1-23
Transmembrane Regions
  • None
Protein Sequence>Glucan 1,3-beta-glucosidase MRFSTTLATAATALFFTASQVSAIGELAFNLGVKNNDGTCKSTSDYETELQALKSYTSTV KVYAASDCNTLQNLGPAAEAEGFTIFVGVWPTDDSHYAAEKAALQTYLPKIKESTVAGFL VGSEALYRNDLTASQLSDKINDVRSVVADISDSDGKSYSGKQVGTVDSWNVLVAGYNSAV IEASDFVMANAFSYWQGQTMQNASYSFFDDIMQALQVIQSTKGSTDITFWVGETGWPTDG TNFESSYPSVDNAKQFWKEGICSMRAWGVNVIVFEAFDEDWKPNTSGTSDVEKHWGVFTS SDNLKYSLDCDFS
References
External Links
ResourceLink
Saccharomyces Genome Database BGL2
Uniprot IDP15703
Uniprot NameBGL2_YEAST
GenBank Gene IDAY558101
Genebank Protein ID45270092
General Reference
  • Baladron, V., Ufano, S., Duenas, E., Martin-Cuadrado, A. B., del Rey, F., Vazquez de Aldana, C. R. (2002). "Eng1p, an endo-1,3-beta-glucanase localized at the daughter side of the septum, is involved in cell separation in Saccharomyces cerevisiae." Eukaryot Cell 1:774-786.12455695
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mrsa, V., Klebl, F., Tanner, W. (1993). "Purification and characterization of the Saccharomyces cerevisiae BGL2 gene product, a cell wall endo-beta-1,3-glucanase." J Bacteriol 175:2102-2106.8458852
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Volckaert, G., Voet, M., Robben, J. (1997). "Sequence analysis of a near-subtelomeric 35.4 kb DNA segment on the right arm of chromosome VII from Saccharomyces cerevisiae carrying the MAL1 locus reveals 15 complete open reading frames, including ZUO1, BGL2 and BIO2 genes and an ABC transporter gene." Yeast 13:251-259.9090054
  • Klebl, F., Tanner, W. (1989). "Molecular cloning of a cell wall exo-beta-1,3-glucanase from Saccharomyces cerevisiae." J Bacteriol 171:6259-6264.2509432
  • Cappellaro, C., Mrsa, V., Tanner, W. (1998). "New potential cell wall glucanases of Saccharomyces cerevisiae and their involvement in mating." J Bacteriol 180:5030-5037.9748433
  • Martin-Cuadrado, A. B., Fontaine, T., Esteban, P. F., del Dedo, J. E., de Medina-Redondo, M., del Rey, F., Latge, J. P., de Aldana, C. R. (2008). "Characterization of the endo-beta-1,3-glucanase activity of S. cerevisiae Eng2 and other members of the GH81 family." Fungal Genet Biol 45:542-553.17933563