You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUridylate kinase
Synonyms
  • UK
  • Uridine monophosphate kinase
  • UMP kinase
Gene NameURA6
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionFurnishes the cell with pyrimidines. Accepts UMP, and dUMP as phosphate acceptors with high activity; to a lesser extent, it can also use IMP, GMP, dGMP, 5-iodo-dUMP, XMP, and dTMP as substrates. ATP and dATP are the best phosphate donors; can use GTP, dGTP, dCTP, and dTTP to some degree (30-50%)
Cellular LocationCytoplasm. Nucleus.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + Uridine 5'-monophosphateUridine 5'-diphosphate + ADP
Adenosine triphosphate + dUMPdUDP + ADP
Metabolites
YMDB IDNameView
YMDB00049Uridine 5'-monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00221dUMPShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00746dUDPShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
nucleotide kinase activity
catalytic activity
phosphotransferase activity, phosphate group as acceptor
transferase activity
nucleobase, nucleoside, nucleotide kinase activity
transferase activity, transferring phosphorus-containing groups
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL024C
Gene Sequence>615 bp ATGACAGCTGCCACTACATCACAGCCAGCTTTCTCGCCTGACCAAGTTTCCGTGATCTTC GTTCTAGGAGGACCCGGTGCAGGCAAGGGTACTCAGTGTGAAAAACTAGTTAAGGACTAT TCATTTGTCCATTTGTCAGCCGGAGACCTTCTACGTGCTGAGCAGGGCAGAGCAGGTTCC CAATATGGGGAATTGATCAAGAACTGCATCAAAGAGGGCCAGATTGTCCCTCAAGAGATT ACTTTGGCGCTTTTACGCAACGCTATTTCCGATAACGTCAAGGCGAACAAGCATAAGTTC TTAATTGACGGATTTCCTAGGAAGATGGATCAAGCCATTTCCTTTGAAAGAGACATCGTT GAAAGCAAATTCATCCTGTTCTTTGACTGCCCTGAAGATATCATGTTAGAGAGACTATTG GAGCGTGGCAAGACCAGTGGTAGAAGCGATGACAACATTGAGTCCATTAAGAAGAGATTT AACACTTTCAAGGAGACTAGTATGCCCGTCATCGAGTACTTTGAAACCAAATCGAAAGTC GTCCGTGTTCGTTGCGACAGATCCGTCGAAGATGTGTACAAAGACGTCCAAGACGCTATC CGTGATAGCTTATAG
Protein Properties
Pfam Domain Function
Protein Residues204
Protein Molecular Weight22933.0
Protein Theoretical pI6.53
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uridylate kinase MTAATTSQPAFSPDQVSVIFVLGGPGAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGS QYGELIKNCIKEGQIVPQEITLALLRNAISDNVKANKHKFLIDGFPRKMDQAISFERDIV ESKFILFFDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKV VRVRCDRSVEDVYKDVQDAIRDSL
References
External Links
ResourceLink
Saccharomyces Genome Database URA6
Uniprot IDP15700
Uniprot NameUMPK_YEAST
GenBank Gene IDAY558074
Genebank Protein ID45270038
PDB ID
1UKZ
General Reference
  • Liljelund, P., Sanni, A., Friesen, J. D., Lacroute, F. (1989). "Primary structure of the S. cerevisiae gene encoding uridine monophosphokinase." Biochem Biophys Res Commun 165:464-473.2556145
  • Jiang, Z. R., Abaigar, L. T., Huang, S. H., Cai, B., Jong, A. Y. (1991). "Molecular characterization of Saccharomyces cerevisiae URA6 gene. DNA sequence, mutagenesis analysis, and cell cycle regulation relevant to its suppression mechanism to cdc8 mutation." J Biol Chem 266:18287-18293.1655742
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Schricker, R., Magdolen, V., Kaniak, A., Wolf, K., Bandlow, W. (1992). "The adenylate kinase family in yeast: identification of URA6 as a multicopy suppressor of deficiency in major AMP kinase." Gene 122:111-118.1333436
  • Jong, A., Yeh, Y., Ma, J. J. (1993). "Characteristics, substrate analysis, and intracellular location of Saccharomyces cerevisiae UMP kinase." Arch Biochem Biophys 304:197-204.8391780
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Muller-Dieckmann, H. J., Schulz, G. E. (1994). "The structure of uridylate kinase with its substrates, showing the transition state geometry." J Mol Biol 236:361-367.8107116